SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000021583 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  69293.ENSGACP00000021583
Domain Number - Region: 455-494
Classification Level Classification E-value
Superfamily EGF/Laminin 0.046
Family Integrin beta EGF-like domains 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000021583
Sequence length 736
Comment (Gasterosteus aculeatus)
Sequence
VTFVSELSSKPAQKLSKYGWYGNVRLQKFHIPEETAVARWLFSVTKGHTFHCGQHNVTIY
IQYGAPPVINPTETVFPNATLWSPCLSLILPVTSQSSMTFNLSNPAPGDWYIGAHLPEDD
GRIEQKGFPSCSYFFQPQLSIRRAVDTPILQPDTIIQQTAAPDRPARLKLYVPEFASSLS
VSVADCSSEDGADSGNCSLVLRLGSTSLQHRPVTVNCSGFGCSASLTNPPWDTWLRVVVE
SRLDNRTVTFTIASNCTVGCKPKSVGLETDDDISRLRGNSSSTDSTAASNDSVIADPVTS
SNGSASACVWSIPVIHEEVDVLSLRFTPASGANVSVTDAHPTLLVYPLYTQATGGTLNLQ
LTLNTTNVTLGNSSSVVACLSPRAPVLQLNHSQSCGTALFGGYSLRVNASDPKAVVRLPF
PQSTTWYLTLQLLCYSNDCGNTSSVSVVPEVFISACVEDCGTYGECRLLRSYSYLYAACV
CKAGWSGWGCTDDSAAQSYSRQLTATLLLTLSNLSFLPAIVVAIKRFYITEAAVYLFTMF
FSTFYHACDQPGVAVMCIMDYDALQYCDFLGSVCSIWVTILCMARIRHAFKYSLFMLGAL
LIAMSMQLDRKGLWNLLGPVLCAVLCMVTAWVYRGVQRRHCYPPSWRRWVLFLIPGATCA
LVGVCLYIFTETEDNYYYTHSLWHLLVASCVVFLLPPKEKNREASGWSRGWSWSWRPRVC
GYTLCQSDKDELYTVT
Download sequence
Identical sequences G3PVE6
69293.ENSGACP00000021583 ENSGACP00000021583 ENSGACP00000021583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]