SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000021685 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000021685
Domain Number 1 Region: 141-190
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000009
Family EGF-type module 0.0034
Further Details:      
 
Domain Number 2 Region: 99-134
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000944
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000021685
Sequence length 394
Comment (Gasterosteus aculeatus)
Sequence
AVGGGGNHYARALPPAPDEMTLKHRRTPLLLAVTCMYFSGGSLWSYQQQDDSHGEECSEN
NISTTKYPCMKTSGEVTACYRKKCCKGFKFVLGQCIPEDYDVCAGAPCEQQCTDHFGRVV
CTCYPGYRYDRERHRNREKPYCVDIDECANNSMTTCSQICVNSAGGYRCECEKGFFLEED
EKTCTKGSKFPAVHLFEKSDNVMNVVTCSATCEDFHQIRESVLQLQQKMALLSNSADVPQ
QMTSKKVLIPPMFLPGPPGLPGPPGDPGPEGPPGRSGLSGPPGSPGPRGLMGPIGPTPDL
SHVKRGSRGPVGPPGAPGKDGRKGDRGAAGAVGPPGPPGSFDFLLLLMADIRNDIADLQS
KVYGRAMHSPGDFPAAPDSWRDNQDALDSGSGEE
Download sequence
Identical sequences G3PVP6
69293.ENSGACP00000021685 ENSGACP00000021685 ENSGACP00000021685

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]