SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000021776 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000021776
Domain Number 1 Region: 424-678
Classification Level Classification E-value
Superfamily YWTD domain 1.83e-47
Family YWTD domain 0.0000137
Further Details:      
 
Domain Number 2 Region: 1-243
Classification Level Classification E-value
Superfamily YWTD domain 1.7e-30
Family YWTD domain 0.00012
Further Details:      
 
Domain Number 3 Region: 340-433,674-723
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000000369
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 4 Region: 683-722,766-862
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000124
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 5 Region: 287-333
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000265
Family EGF-type module 0.012
Further Details:      
 
Domain Number 6 Region: 890-935
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000559
Family EGF-type module 0.0015
Further Details:      
 
Domain Number 7 Region: 257-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000232
Family EGF-type module 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000021776
Sequence length 981
Comment (Gasterosteus aculeatus)
Sequence
MDLGGKNQRRLVAGVGSSILLDFHLREETVYWADKHTGVIHKASVRGANRQKLYSSDKHI
SGLAVDWVWNHVYWTSGEKGKIKKMDINGKNEKTLLRHLSQPNSINVDPNNRFLFWLSGG
MSPSIQRSDVTGQMKTTLIKIAEHLGALSIDREDKRLFWVQFGPQGESAIASCDYDGNGL
HIIDHPLWSQSLAVSVFLEHLYYTDASSRVIKRVNKFAGGKPLDVNMKQMAKPPVSLKVV
HPLNQPMADSQSSPPGCDEKSGNCVNVCSSLAEQGTCQCTEGFALSMQGSYCEDVNECAH
WNHGCSLGCENIPGSYFCTCPTGYALLPDRKTCGESEITPCEGNMTKKCGDGCLTADGGA
VCVCPEGSSLQEDGQACTGCLSADRGGCSQLCIPVSPTGWQCGCLPGYLLHRDGERCVAS
GPPPYLLVANLVDVRQIHPGGAGDGTLVEDPRGAIIALDYDPVQKSVYFASVGQKRIERV
DLNGGSRDVLVSDGLDSPEGLAIDWIHRRMYWTDKGQSTVDCSTLNGQNRETLVSEGLDK
PRGIAVHPLAKRLFWTDIGAHPVVESASLEGEGRAVVARTHLVSPSGLTIDFTEDRLFWC
DQRRGLVETAALDGSDRRVLLENQVGRPFDLAVFEDRLWITYQKPKQLRSVHKRTGRKLQ
RIHGNMVQPASVVVVHPLAKPGADVCLHLNGGCAQVCESELGLARCSCLPRYVLSPDGRS
CSPGSADKSPPTAPGLSADEAEPDVNSEGGSESAPFTDAMVSDQNECHSLGCDADAQCLL
GAGSPTCVCPQGFTGDGRLCVGMLKICKECSLDEASSRFVSDIDECTQGTHKCDKNAQCQ
NTFGAHLCKCRAGYQGNGKTCLEESEATSPRGTTSRPADVSTRHHGGNSAQSCPSSHESY
CLYQGVCFYYPEMESYACNCASGYIGERCQFSDLEWGELQQAEEEQRRNVAIAACMMALV
SLLSIAACATYCYVPQRDPGG
Download sequence
Identical sequences G3PVY7
69293.ENSGACP00000021776 ENSGACP00000021776 ENSGACP00000021776

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]