SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000021904 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  69293.ENSGACP00000021904
Domain Number - Region: 148-186
Classification Level Classification E-value
Superfamily Pili subunits 0.0361
Family Pilin 0.01
Further Details:      
 
Domain Number - Region: 93-137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0523
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000021904
Sequence length 332
Comment (Gasterosteus aculeatus)
Sequence
MVGVWSSGHAVQSLVGFRTSGALRWLGVTGPASLLERTGLAQAVREGRSFRSSKITNITL
GGVQGDVCDWLLQCPEGYECVFNPGTSNYSCSSRCHFDYCHHRGICTHHPGQLPVCRCLV
GEDFWFMGRRCDVRMTRARLVGACLAVLLIMVTLIGVLALVAVRRYRAILIQAKVDQTRS
SYRRFNHFDELSGRFWLRSWAGSADSLDNPAFTRSDELLHLRALDRPCCYHDDTLSLAST
CPSHGARINTIYPHSSQYGWRGSEVSMADGVLDSGKASDLSVCSWPVEPIHWTPFPLLQQ
LASHRTPAARVSRPRSYCEGMELADLGKSWTA
Download sequence
Identical sequences G3PWB5
69293.ENSGACP00000021904 ENSGACP00000021904 ENSGACP00000021904

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]