SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000022371 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000022371
Domain Number 1 Region: 978-1278
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.87e-79
Family Protein kinases, catalytic subunit 0.000000000357
Further Details:      
 
Domain Number 2 Region: 337-499
Classification Level Classification E-value
Superfamily L domain-like 2.61e-50
Family L domain 0.000000492
Further Details:      
 
Domain Number 3 Region: 33-194
Classification Level Classification E-value
Superfamily L domain-like 1.28e-43
Family L domain 0.000000818
Further Details:      
 
Domain Number 4 Region: 496-621
Classification Level Classification E-value
Superfamily Fibronectin type III 6.4e-29
Family Fibronectin type III 0.00000251
Further Details:      
 
Domain Number 5 Region: 625-704,802-825
Classification Level Classification E-value
Superfamily Fibronectin type III 5.44e-22
Family Fibronectin type III 0.000089
Further Details:      
 
Domain Number 6 Region: 796-939
Classification Level Classification E-value
Superfamily Fibronectin type III 6.08e-22
Family Fibronectin type III 0.0001
Further Details:      
 
Domain Number 7 Region: 175-339
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000471
Family Growth factor receptor domain 0.00000316
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000022371
Sequence length 1371
Comment (Gasterosteus aculeatus)
Sequence
MVFRCDSVMWLRTLCFVVTAVCVAVSCHRASGEVCPSKDIRNNVTNLHTLENCTVIEGHL
KILLMFSTKPEDFRGLSFPKLTVVTDYLLLFRVSGMETLSNLFPNLTVIRGNKLFFNYAL
VMFEMLHLREIGLHSLMNITRGAVRIEKNSDLCYLSTLDWSKILDTVEDNYIMANKNGRE
CGDVCPGVAIGKTTCQSTTINGHFSERCWTQNHCQRMCPVQCKHRACTKDDQCCHEQCLG
GCLKPHSAGHCVACRGLQHGPSCVERCPADHFTYKGWRCVPFAFCQDLHNKCKREKEHSK
SADCHEYVIHDGACVPECPSGYTTVNSSSLNCTPCAGLCPKVCMGLKVVDSVTAAQDLRG
CSVLNGSLVIKLRGGNNIAAELETSLGQLEEITGYLSVRRSYALVSLSFFRKLRVIRGEE
QEIGNYSFYALDNQNLRQLWDWSKHNLTILQGRMFFHYNSKLCMAEIKKMETVTGTKERN
VKNDIALKTNGDQASCENYVLKFTQIRTSSDKIMIRWEPFWPPDFRDLLGFMVLYKEARP
FQNVTEFDGQDACGSNSWVIADVDPPQRATEGDKEQFEPGHLIMPLKPWTQYAIMVKTQL
SASDEHQVNGAKSEILYVRTNSTKPSVPLEPMSSSNSSSQIILKWKPPNDPNGNITHYLV
FCQRQPEGSELYKFNYCQKGMKLPSRVPTQVDSHEEQKWNQTEERGQGKRCCDCPKTEKE
LKKEKEDSDYRKTFEDYLHNEVFEIKRSRKRRSAVGIANWTLPFLTTAPSPPHGTGMPED
EDAFEITRITVDVKAHAKESTVISNLRHFTSYQIEVHACNDKENPLSCSMAAYVSARTMP
EDKADDIRGPIKYEVTENVVHITWQEPVSPNAVIILYEVNYKRLGDTDELHYCVSRNMYK
VARGCKLKVMHPGNYTVRIRATSLAGNGSWTEPTYFFVQDPSDSLYVLKIIIGPVICFVL
LLFVAVAGFVMFKKNQTQGPSGPIYASSNPEYLSANDVYEADEWEVPRDKINILRELGQG
SFGMVYEGIGKDIIKGEGDMHVAVKTVNESASLRERIEFLNEASVMKAFTCHHVVRLLGV
VSKGQPTLVVMELMTNGDLKSFLRSLRPDAENNPGRPPPSLKEMIQMAAEIADGMAYLNA
KKFVHRDLAARNCMVAHDLTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMAPESLKDGV
FTANSDCWSFGVVLWEISTLAEQPYQGLSNEQVLKFVMDGGYLDRPDNCADRIHNLMQMC
WQYNPKMRPAFQEVIEMLREDLHPSFREVSFFYSEENKPPETEDFDLDMENMESIPLDPS
SYSQREQCSDRDEGLSMGLRGSYEEHHIPFTHMNGGKTNGRILALPRSSPS
Download sequence
Identical sequences G3PXN2
69293.ENSGACP00000022371 ENSGACP00000022371 ENSGACP00000022371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]