SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000022509 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000022509
Domain Number 1 Region: 514-672
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.53e-41
Family MAM domain 0.00097
Further Details:      
 
Domain Number 2 Region: 676-836
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.54e-40
Family MAM domain 0.0013
Further Details:      
 
Domain Number 3 Region: 838-1006
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.16e-39
Family MAM domain 0.0046
Further Details:      
 
Domain Number 4 Region: 1-154
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.9e-31
Family MAM domain 0.00075
Further Details:      
 
Domain Number 5 Region: 202-361
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.96e-17
Family MAM domain 0.032
Further Details:      
 
Domain Number 6 Region: 427-499
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000269
Family MAM domain 0.0031
Further Details:      
 
Domain Number 7 Region: 158-195
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000942
Family LDL receptor-like module 0.002
Further Details:      
 
Domain Number 8 Region: 388-427
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000262
Family LDL receptor-like module 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000022509
Sequence length 1014
Comment (Gasterosteus aculeatus)
Sequence
CSFENGTCGWDDRSSGQCQWTRGRNGTGNTGPSVDNTLSTELGWYLAVAPKRGDDVSLAA
VHSPPMRQASATCTLHFHYSMNGEDGEMLNVLLNEGSRTTALWWLSGNHGDAWHPAEVTV
GRIPQDFTVLFEACRSFNRPGHVAIDDIHFTNCTLPEPEPSCPPNTFVCNNSVCVEHSRV
CDFSDDCGDWSDERKLESQAHLDVHFEQGLCFWEKNEVDTAAVGWTHHRGQEAWPKHGPP
RDHTYNSDAGHYAVPGNLIENSETSETLSKTLLPSSNCTVRFFYFGLDDVTARLTARSRM
LRSGSGDALLWCWENSQSFSWRRAEVTFSSSVNSKIVFRYERGDGLGGLVALDDVSFSRE
CLFDPDNNKLPDPSTTSAPPTSATAPCQALQDGEFLCWRSPDKVCIPAALRCDYHPDCPQ
AEDEDGCGGCTFERDQCEWTDTSDGHGRWQRQRASNDTEPPTDHTAGTGYYMRVNLSRES
TQTEARLQSPPLAPSSLYCQILPAPAAVSALAAGGCSFEDGLCVWVQGAEDELDWLSNSG
PTETPNTGPAGDHTTGKGKYIYIKSSRPSVKGNVAQLKSTLLPSAGDQGYCFTFWYHMFG
ATAGSLRMLLLTAEPLKKTLVWQNSGNQGDEWLRVQSHVTSQNVHQVILEATVGGEAGDI
AIDDISLVGGPCPASDACDFEEGSCGWQQGTTDDFDWVRMSGSTHNPNTGPESDHTTNTP
AGHYYCLPSSAADAAGQTAKMSSPLYPAGKGACLQLWYHMYGRGTGLLNVYQQSEEGKRA
LIFSQTGNQGRLWRFAQASLLPRVQPYRIVVEGVKAGPTQEGDMAFDDVQLTDTQCPPPG
HCDFESNWCSWSNLGGGVDQGDWLRGRGASPNPNTGPSVDHTTNSTHGFYLYVDSSVGEW
GDLSFLVSEVFQPSPRGHCLTFWYHMYGSHVGTLRVYINDRKTHAGDNEEGILKWIETGN
RGDEWQEASVTVKHSEAFWFVFVYQRGMNTGGDVSLDDITILPGGCYSEPPIDP
Download sequence
Identical sequences G3PY20
69293.ENSGACP00000022509 ENSGACP00000022509 ENSGACP00000022509

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]