SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000022551 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000022551
Domain Number 1 Region: 99-244
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-17
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 2 Region: 231-269
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000838
Family EGF-type module 0.0069
Further Details:      
 
Weak hits

Sequence:  69293.ENSGACP00000022551
Domain Number - Region: 274-301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00081
Family EGF-type module 0.022
Further Details:      
 
Domain Number - Region: 44-78
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000838
Family EGF-type module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000022551
Sequence length 438
Comment (Gasterosteus aculeatus)
Sequence
MQGACVSVVCVCICVSVLLRSAISQPPTESDTYTECTDGYHWDHQTEHCKDINECEIIPD
ACKGEMKCFNHYGGYLCLPRSASVIPASEPPITPAETSRCPAGYEAQGDSCVDVNECERE
EDDCQPSQQCINTLGAFTCQCPDGYRKVGTECIDIDECRYRYCQHRCVNVPGSFSCQCEP
GFQLAGNNRSCIDVNECEMGAPCSQRCSNTYGTFLCRCDQGYELGADGFACNDIDECSYS
SYLCQYRCVNEPGRFSCMCPEGYQLQGTRLCQADINECETGEHQCGEAQTCVNIHGRYQC
VDTNRCQEPYVQVSENRCVCPVNKPACRDLPFSIVHRYMSITSERSVPSDIFQIQATSVS
PGAYNTFRIRSGDENADFYIRQINNISAMLVLARAVSGPREYTLDLEMVSVNPLLSYQGN
YQTSSALRLSIYVGPHSF
Download sequence
Identical sequences G3PY62
69293.ENSGACP00000022551 ENSGACP00000022551 ENSGACP00000022551

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]