SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000023782 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000023782
Domain Number 1 Region: 101-189
Classification Level Classification E-value
Superfamily SEA domain 0.0000000209
Family SEA domain 0.0074
Further Details:      
 
Domain Number 2 Region: 288-368
Classification Level Classification E-value
Superfamily SEA domain 0.00000732
Family SEA domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000023782
Sequence length 416
Comment (Gasterosteus aculeatus)
Sequence
MTSPPMNMTSPPMNMTSPTMNMTSPAVNMTSPPMNMTSRPMNMTSAVVNMTSPQVNMTTM
STRSPSENATSPLVNGTSPNITTGSLATTTAPPAPDTTIQLRFSLIETFEQQLADTTSQK
FKDLANRVTAALDNIYRSRFGRRFLRSLIRAFRQGSVVVESELIFANATSVQDVDDVRVT
LVEAASNNSNFSLSVNVSTIVATAPTATTNATVAPTAAPTAAPTVAPTAAPTAAPTVAPT
AAPTATAAPTGVTNATAAPTAAPVATEAPASTDPPTSSEGTLRLLLSLNRTFTSDLSNRS
SAAFKTLAAEVIQEINRVARIIYASSFRRTLINNFTSGSVKVDTTLVFQDKSSVPQASTA
TAQFISLLSNSSLGIVPGSISAQSTSTSGSPPMATMGSLAVFSLTLLAVAQMLVTL
Download sequence
Identical sequences G3Q1N4
69293.ENSGACP00000023782 ENSGACP00000023782 ENSGACP00000023782

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]