SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000023820 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000023820
Domain Number 1 Region: 153-272
Classification Level Classification E-value
Superfamily EF-hand 7.11e-31
Family Osteonectin 0.012
Further Details:      
 
Domain Number 2 Region: 241-335
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 3.92e-25
Family Thyroglobulin type-1 domain 0.00068
Further Details:      
 
Domain Number 3 Region: 91-137
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000123
Family Ovomucoid domain III-like 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000023820
Sequence length 345
Comment (Gasterosteus aculeatus)
Sequence
LPSHQHYLGSIKAYSVFSDHTLLQEPGTWTPSKPFDQGLDPAKDPCLKIKCSRHKVCVSE
DYKTATCVSQRRVSFRTGCPALSVYQSPGSKCKPCPVVHPSPVCGTDGHSYSTKCKLDYQ
ACITGKKIAVKCSGMCPCPSQPEQSSAENCRSPVCSESDLKEVVNRLRDWFRVLYENGNH
KRVKIQKPEKNKFEVGTSPICKDPVGWMFPRLDTNFDVQLDQSEIKSLYLDRNEPCSDAF
FKSCDTHMDKVITSSEWCTCFQRYTDSPCKEELSSINKKQAGKKVIGQYLPSCDEEGYYR
SHQCHSSSGQCWCVDRYGNEDASSRTHGPANCGVILESSGDLGSG
Download sequence
Identical sequences G3Q1S2
69293.ENSGACP00000023820 ENSGACP00000023820 ENSGACP00000023820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]