SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000025433 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000025433
Domain Number 1 Region: 10-189
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.19e-44
Family G proteins 0.0000214
Further Details:      
 
Domain Number 2 Region: 189-228
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000017
Family SOCS box-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000025433
Sequence length 286
Comment (Gasterosteus aculeatus)
Sequence
MGTQSSPVKSYDYLLKFLLVGDSDVGKGEILDSLQDGSVESPYAYSSGIDYKTTTILLDG
RRVKLELWDTSGQGRFCTIFRSYSRGAQGILLVYDITNGWSFDGIDRWIREIDEHAPGVP
RILVGNRLHLAFRRQVPTEQARAYAEKNSMTFFEVSPLCNFNVIESFTELSRIVLMRHGM
EKFWKPNRVFSLQDLCCRSIVSCTPVHLIDKLPLPVAIKSHLKSFSMANGMNAVMMHGRS
YSVANSAASGGGGSKANSLKRSKSFRPPQSPPKESSLSLKGSCKIS
Download sequence
Identical sequences G3Q6C4
ENSGACP00000025433 69293.ENSGACP00000025433 ENSGACP00000025433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]