SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000025572 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000025572
Domain Number 1 Region: 2-188
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.41e-52
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 202-245
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000301
Family SOCS box-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000025572
Sequence length 245
Comment (Gasterosteus aculeatus)
Sequence
QLLIRSGASVNIVAVDSITPLHEACLRGQAQCVRLLLDAGAQVDARNVDGSTPLCEACSA
GSLECVQLLLDHGAMADPALTSRTASPLHEACMGGNSDCVRLLIATGASLEAYDLYYGTP
LHVACANKHTDCVKELLNAGAKVNAARLHDTPLHHAAKTMQVEMVETLVEFGANVYARDQ
HNKRPVEYTTPGSPSATCLTFYESNPMSLQQLSRLALRTELGTRALKVIGQLNIPKLIIN
YLCYY
Download sequence
Identical sequences G3Q6R2
ENSGACP00000025572 69293.ENSGACP00000025572 ENSGACP00000025572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]