SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000025606 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000025606
Domain Number 1 Region: 471-604
Classification Level Classification E-value
Superfamily TIMP-like 3.3e-39
Family Netrin-like domain (NTR/C345C module) 0.011
Further Details:      
 
Domain Number 2 Region: 286-344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000712
Family Laminin-type module 0.029
Further Details:      
 
Domain Number 3 Region: 342-395
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000307
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 4 Region: 405-444
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000977
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 5 Region: 95-176
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000184
Family APC10-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000025606
Sequence length 607
Comment (Gasterosteus aculeatus)
Sequence
MRAVDVALAVLLAASLSCRSALGGYGASLFAAQTSPPDPCNDEHGNPRRCIPDFVNAAFG
KDVRASSSCGKTPGRYCVVTAAEKGDERTRSCHTCDASDPKKCRPPAYLTDLNNPHNLTC
WQSENFVQYPQNVTLTLSLGKKFEVTYVSLQFCSPRPESMVIYKSMDYGKTWVPFQFYST
QCRKMYNKPNRAAITKQNEQEAVCTDSHTDMYPLTGGLIAFSTLDGRPSAHDFDNSPVLQ
DWVTATDVKVIFSRLHTFGDENEDDSEVARDSYFYAVSDLQVGGRCKCNGHASRCVKDRD
GGLVCECKHNTGGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKL
SGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDLSKPISHRKACKACDCHPVGAAGKTCNQT
TGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIRVEIPVAPPTTPSSSTEEPSDCDSYCK
ASKGKLKINMKKYCKKDYAVQVHILKADKSGEWWKFTVNIISVYKQGESRIRRGDQFLWV
RAKDVACKCPKIKPGKKYLLLGNDEDSPGQGGVVADKGSLVIQWRDTWARRLRKFQQREK
NGKCKKP
Download sequence
Identical sequences G3Q6U6
ENSGACP00000025606 ENSGACP00000025606 69293.ENSGACP00000025606

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]