SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000026458 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000026458
Domain Number 1 Region: 24-178
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.92e-31
Family Laminin G-like module 0.0059
Further Details:      
 
Weak hits

Sequence:  69293.ENSGACP00000026458
Domain Number - Region: 202-234
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000126
Family EGF-type module 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000026458
Sequence length 256
Comment (Gasterosteus aculeatus)
Sequence
SMTRGSRFLCWPLALFSVLTSVKMLEFGGAPGQWARYGRWEAGSVGELSFSLKTNISKAL
VLYLDDGGNCDFLELLIAGGRLQLRFAIHCAEPATLHMETRVNDDRWHMVLLTRNFRETL
LMVDGETKVAEVKSKRKEMAVVSDLFVGGIPPDVRLSALTSSTVKYEPPFQGLISNLKVG
EMPPTLLNSQGIQSDLEYLCTKQNPCFNGGFCSIQYGEVHCDCTHTRFKGKYCKEGKQPS
HCTCSSLLCSCAVLWA
Download sequence
Identical sequences G3Q993
ENSGACP00000026458 69293.ENSGACP00000026458 ENSGACP00000026458

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]