SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000026720 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000026720
Domain Number 1 Region: 472-713,763-825
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.03e-53
Family Ankyrin repeat 0.00051
Further Details:      
 
Domain Number 2 Region: 727-1079
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.81e-52
Family Ankyrin repeat 0.0000421
Further Details:      
 
Domain Number 3 Region: 229-530
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.58e-32
Family Ankyrin repeat 0.00033
Further Details:      
 
Domain Number 4 Region: 1080-1163
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 3.41e-18
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0011
Further Details:      
 
Domain Number 5 Region: 56-166
Classification Level Classification E-value
Superfamily POZ domain 9.42e-18
Family BTB/POZ domain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000026720
Sequence length 1169
Comment (Gasterosteus aculeatus)
Sequence
MAEEEVAKLQKHLALLRQEYVKMQQKLADTEKRCAVLAAQASSQGSSSPAAATAADTFIS
RLLVIVADLYRQEQYSDLKVKVAGEDLCAHKFVLAARSDAWSLANLASTFELDLSDCKSE
VAMAMLRWAYTDELELAEDDAFLIDLMKLANRFQLQLLRERCEKGVMSSVNVRNCIRFYQ
TAEELNATTLMNYCGEIIASHWDDLRKEDFSTMSAQLLFKMIKSKTEYPLHKAIMVERED
VVFLYLIEMDSQLPGKLNELDNNGDLALDLALARKLESIATTLVNNKADVDMVDQSGWSL
LHKAIQRGDEFASIFLIRHSAQVNAATVGAVETPLHLVCSFSPKKHTVEVMTGMARIAEA
LLKTGANPNMQNSKGRTPLHEAVSSGNEPVFNQLLQCKQLDLELKDHEGSTALWLALQYI
TVASDPSVNPFEDDASVVNGTSFDENSFAAQLIQRGSNPDAPDTTTENCLMQRAARAGNE
AAALFLATHGAKVNHVNKLGESPLHTACRSGLANLTAELLQQGANPNLQTQKPLPDDTVG
VATQTPLHMAIAHNHPDVVSVILEQKANALHATNNFQIIPDFSLKDSMDQTVLGLALWTG
MHNIAAQLLGSGASINDTMSNGRTLLHMAIQRQDSKSALFLLEHQADISVRTQEGQTALQ
LAISNQLPLVVDAICTRGADMSVVDDKGDPPLWLALENGLEDIASTLVRHGCDATAWSTG
PSGCLQTLLHRAVDENNEVTACFLIRSGCDVNSTRKPGPNGEGDEEARDGQTPLHLASSW
GLEDVVQCLLEFGANVNAQEAEGRAPIHVGISNQHNNIIQLLISHPDIRLNLRDRQGMTP
FACAMTHKNNKAAEAILKREPGAAEQVDNKGRNFLHVAVQNADIESVLFLISVQANVNSR
VQDAAKLTPLHLAVQAGSEIIVRNLLLAGAKVNELTKHRQTALHLAAQQDIATICSVLLE
NGVDFAAEDENGNNALHLAVMQGRLNNVRNLLTESNIDAEAFNLRGQSPMHVLGHYGKEN
AAAIFELFLECMPEYPLDKCDNEGNTVLLLAYMKGNANLCRAIVRAGARLGINNNQGINI
FNYQVATKQLLFRLLDMLSKEPPWCDGSNCYECLAKFGVTTRKHHCRHCGRLLCHKCSIK
EIPIIKFDLNKPVRVCDICFDVLTLGGVS
Download sequence
Identical sequences G3QA04
ENSGACP00000026720 69293.ENSGACP00000026720 ENSGACP00000026721

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]