SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 69293.ENSGACP00000026820 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  69293.ENSGACP00000026820
Domain Number 1 Region: 183-297
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 4.84e-32
Family Spermadhesin, CUB domain 0.00025
Further Details:      
 
Domain Number 2 Region: 36-146
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.96e-31
Family Spermadhesin, CUB domain 0.00029
Further Details:      
 
Domain Number 3 Region: 368-487
Classification Level Classification E-value
Superfamily TIMP-like 2.83e-31
Family Netrin-like domain (NTR/C345C module) 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 69293.ENSGACP00000026820
Sequence length 487
Comment (Gasterosteus aculeatus)
Sequence
HVNALLTQMLWSLRSPWGSGWTKAQETNYSRPVFRCGGDLVTDSGFVGSEGFPRFYKPNS
KCTWRITVPEENVVMLSFRAFDLETDPRCRYDYLDVYNGQSNQMQKLNRLCGTRRPGSLI
STTNTITLEMVSDEATQGKGFLAYFSGAKPYVDDNTKAQRSRLIVHVKTDTISGIFVSDQ
QFCGSKMTKAQGEIKTPNWPDNKYPASTSCSWLVIVDPGNQVIQVKFDKFVLETDTYCRF
DYVAFFNGGADDTSLIGKYCGDQAPQPITSSGNVLIVQFVSDSSVTSDGFLAHYTSVPGA
PQILTFNSAAGTGSIPSKPAALPAATIKPPVPTAKYVPPEPTRKPKPVKPTRGRGQGTTG
QDRRPPVTTPNACKRDGKIQSSFCASEFVITGKVTSLARQQGTFRIGITLIRVYKAGGLT
MTPVGETVSVKLVSQCRNCPFLSKGADYIIMGQVDEEGRGTLKPGAFTAPYKAQHERLLM
NVSQQPC
Download sequence
Identical sequences G3QAA4
ENSGACP00000026820 ENSGACP00000026820 69293.ENSGACP00000026820

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]