SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW002131-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6945.ISCW002131-PA
Domain Number 1 Region: 351-409
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000135
Family Variant RING domain 0.01
Further Details:      
 
Weak hits

Sequence:  6945.ISCW002131-PA
Domain Number - Region: 2-25
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00778
Family Integrin beta EGF-like domains 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW002131-PA
Sequence length 472
Comment (Ixodes scapularis)
Sequence
NCSGHGECHQGICFCEVQYSGGTCTDPNISYFVAFSTIFYLICAVSFVQLLICIRSEFSR
IKPPSLLKALKVTTQKALYALICIATFARGFYFSSPENASLDWASSLMSAYYPLLLTGSS
LIVCFWAEVFHLRDLRHDKPRFLSKSFLGFLAFNIITYSLLLAELVLIQFAGYGETERVS
FFTFCTVVLSRSVVGWGNFSPLFYGKLCEILPPSVLQVRGAFVAGPPSAPNMSQVHQSRL
GLVAFAILLLTTVLFILSDVMGSFWKDKVAVLGRNCHDVMFRVIEMGLALWFPCVLWNCV
QPQQLWILNPKKLLVRREPDKTPPTGPESEALFSVPKELAKSGGDSLEKLPECFICYDSD
RTDAGPLIRPCNCKGDVSVVHHDCLRTWLIESAGNADSNRCKVCNEEYELERGEVWLPSG
LSPAHWLQTAAVLVIMGSAVSGACLVVKVFDNVGIRTLAVGLALLAEYVCLR
Download sequence
Identical sequences B7PCN4
6945.ISCW002131-PA XP_002410054.1.51680 ISCW002131-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]