SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW003427-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6945.ISCW003427-PA
Domain Number 1 Region: 87-135
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000222
Family TSP-1 type 1 repeat 0.0018
Further Details:      
 
Domain Number 2 Region: 62-86
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000575
Family Somatomedin B domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW003427-PA
Sequence length 283
Comment (Ixodes scapularis)
Sequence
MRLVRWLLAVGSWVLVQAAPDPARRQAEGSCRAAGLCCPGRDASCVVQKAVLNTIVEDPD
EGACYCDHACLRLGDCCHDFKESCGVVDCQMSEWGPWSECDASCGPGVMSRDRTVLGQPR
NGGLPCTELLQRRGCYGMRCESMPDDTLHRETAMLLPVTFSQLRYMNDSYDIRQNLKYLP
KSELSKENNATKPYVVLFEVTKTRKACETLEAFSVLKSSQHLCVSCESTAMRKHLGHRCT
GHGIEGMNTRFAALGHLHCHGRWQRVDTLQHCPHGRQPDFIFV
Download sequence
Identical sequences B7PBG4
6945.ISCW003427-PA XP_002408125.1.51680 ISCW003427-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]