SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW003825-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6945.ISCW003825-PA
Domain Number 1 Region: 7-118
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-24
Family Spermadhesin, CUB domain 0.00038
Further Details:      
 
Domain Number 2 Region: 139-258
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.00000000000196
Family Spermadhesin, CUB domain 0.0046
Further Details:      
 
Domain Number 3 Region: 471-517
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000641
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 394-432
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000016
Family EGF-type module 0.011
Further Details:      
 
Weak hits

Sequence:  6945.ISCW003825-PA
Domain Number - Region: 439-475
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00162
Family EGF-type module 0.032
Further Details:      
 
Domain Number - Region: 273-365
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0222
Family Spermadhesin, CUB domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW003825-PA
Sequence length 1389
Comment (Ixodes scapularis)
Sequence
MPTDMNSTLTAPSGTLTSLNHPAHYLNDLRYSVSIVGPPGSRIYLSFSRLDLEWQASCLY
DYLELVSPGEAKESVRICGQHELDLDRFDHFSEGNELRLVFHSDYSVTATGFAASWVTIE
MASLCEDPPATLTAHLDRPKSLSSPHYPLFYPNNMHCRNVIKSEAPNVPVFLTVADLDVG
TWNRTSSPGLCLNDHVNVSLGSMSEGPAAVSLCGGAENPSVQRGFQLLSYGDTLKLALLA
GERRGKRHRGFNFTYQALDRTTLETILQLPARSKGIVHSVNFPHRPPKALSYSTRLMAPL
GHSIEVRFANRTGSRKKAARTSAITLRDPYRNPPATLRLNNDAASALVHNVTATSTLHTL
RLAYLASAAPFVLHYVTRKDPAYLDKTVTLLAGVSLDSCSPNPCLNGGSCVESSKTLACS
CQPPFAALFCHMHACEVGEPCSGRGNCSVSASGSLHCACQRGFEGADCSKRIDPCAGSPC
RSQGRCVAYNGSYVCHCSIFFEGPHCEKQVLQLPYRPLSQRMLEEPFWLGLITVSAVLLL
ILLVYCIKRKFADKIEKSIATGDPLQPEFHPAESDASKLKSSAVPTIVAQPHPAAQRSQR
AGGFQPFRQGAGGLHVQLSTSSSSGRRSPPAPRSSRPTPAIATTRCRHQRTGAAPKEKES
ETARILASLVTSTKSPGKRRMSLDEFIKLSERKIHSIRREETPGDISDVSVASEGSVETS
FVQRLTAAEFHSIREQSLERNSSSDSLGTGPKTSQVQAEVTPIPESPSKASFREGADQDA
VSSSSRSPSPRSLVEQQSSSVEERCREPASRTGSPSPAVTEASPVAIDAPRASGDPKGAF
LDLLQKTMLAAAPASFPKSPTKQPPYEATQVSMLSLPKAGSGCRQKAVDLSVPRKYSVEL
PMPKILITANVSSCESEEAPSPPRTPNPSSKTMSYLSPLTIMCSSADRTISESNLSTSGY
SSLSSPGLSRCNSSSPIADELENPAHHVRRASVSPKSSLSPSYLAEKCGGKTFQFPVAQA
YPYLEAQRPTSPLIQKRRSSVGGALCPATPSLKERAALKGKYRARHSYQTTSTEDSVDDE
GIGIDIAEIKLSKSCIRGGGSVDIILDTGKFDVPERDVSRATSPFAKSMSFESPRCRKGD
KHRKGDKHRRLTPTSSPGVSPGVSPGVSPGVTPGITPGASPSSESLPCALADVPLPRNPS
KSSVAAMAHSTSDSDDGELRPQQRRPCKKQHDSRSVSPMFLCKSPGSTSSDSLPSTNEDL
VGTDCSSTDCGVDRTGGQAFSELAIVIDSSHCPGGRYGAQTIELYPCMPHPRLRVHPPQR
REEGTNTPRCFPGGDRGDRGSSTPSLRLISPEGGTFRSLDVASDARERSPRPPRRRVDEP
CPHSLLVLL
Download sequence
Identical sequences B7PJ10
XP_002406710.1.51680 6945.ISCW003825-PA ISCW003825-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]