SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW005781-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6945.ISCW005781-PA
Domain Number 1 Region: 3-158
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-34
Family Laminin G-like module 0.0021
Further Details:      
 
Domain Number 2 Region: 171-257
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000158
Family Laminin G-like module 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW005781-PA
Sequence length 262
Comment (Ixodes scapularis)
Sequence
AEPLHLDGKSYVSMDLSRRPITSTEDSLRLRFRTNQADGLLLYSRGAQRDLLALQLVHNK
LLFSADLGGEGVVTEVTCGSLLDDNIWHDVHISRFRRELVFSVDRVVVRRVLRGDSFQLD
LNNELFIGGLPNFNQEGIKVAANFSGCLENLFLNDTNVIHELRHQDDRSLVYTRFGQVLY
NCRFEQVVPITFVSSEAMLKVGGYMQRVMNCSFDFRTFNEQGLLLYNKFSVEGYVKLFLD
TGRIRVELQGKKTPVVLLRPFD
Download sequence
Identical sequences B7PPB5
XP_002435607.1.51680 ISCW005781-PA 6945.ISCW005781-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]