SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW006048-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6945.ISCW006048-PA
Domain Number 1 Region: 11-236,268-319
Classification Level Classification E-value
Superfamily Subtilisin-like 3.01e-73
Family Subtilases 0.00000000525
Further Details:      
 
Domain Number 2 Region: 315-453
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 3.87e-40
Family Proprotein convertase P-domain 0.0000732
Further Details:      
 
Domain Number 3 Region: 514-577
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000165
Family Growth factor receptor domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW006048-PA
Sequence length 581
Comment (Ixodes scapularis)
Sequence
LCMQNRGKALDMNVQRVWQRNITGRGVVVTILDDGLEKDHPDLVDNYDPQASWDMNNHDP
DPQPRYDLVDSNRHGTRCAGEVAAVKNNSICAVGVAFGAGIGGVRMLDGDVTDIVEARSL
ALNDQHIDIYSASWGPDDDGKTVDGPGELATRAFRDGIEKGRGGLGSIFVWASGNGGRER
DNCNCDGYTNSIWTLSISSATENGLVPWYSEACSSTLATTYSSGSTGERQIVSWLRALTS
SGNLACSLWSHSDQRGHGFLRTSGSRKLTWRDMQHIVVRTAKPANLHASDWLKNGVNRNV
SHSFGYGLMDADAMVMLAKRWVTAPPQKMCMVRAQPMDKLIPAKSHVELKLNVTCENVRF
LEHVQAKVTLSATRRGDLHIYLTSPAGTRSTLLAQRPLDNSRSGFQAWPFMSVHTWGESP
NGEWRLEIHNDGRYYATLREWFLILYGTTEDPDAWVGATPQAPKLPEKEGLPSPPPTVTA
SRKTTTTAPKKEQTTTPAQQTTKTPQHSSPDSFPECPFPKYSSWGACVDKCPPGTYPTPS
PIPMADTQRSTLACLRCHYSCRACHGPNDNECSSCFSDADL
Download sequence
Identical sequences B7PPF6
ISCW006048-PA 6945.ISCW006048-PA XP_002435648.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]