SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW009338-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6945.ISCW009338-PA
Domain Number 1 Region: 134-167
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000143
Family EGF-type module 0.017
Further Details:      
 
Weak hits

Sequence:  6945.ISCW009338-PA
Domain Number - Region: 64-166
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0439
Family Growth factor receptor domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW009338-PA
Sequence length 246
Comment (Ixodes scapularis)
Sequence
MIPLLLIICIVGVVNVSGSSDLPPQVPQAQLEDKSTDLSEEDRCLTDFKDEAEIFEGKLE
CQKDSENGYKLACVGQYREYMSYKKGDLTIEICELKECQEYCTEEGEECLENECVCKKSH
FVSEGGKCIPYCIKKDPCQNGGKCTLSEKTPFHCRCKPGFKGPLCELEDVIMATTIRNTV
VVGVVFGILIVLCLAVAIVIIQRVEKKLPQRNTVLVNADSAWQTRLYATTNGPCLKCSYF
ISRSRA
Download sequence
Identical sequences B7Q067
ISCW009338-PA 6945.ISCW009338-PA XP_002407006.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]