SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW015652-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  6945.ISCW015652-PA
Domain Number - Region: 53-79
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000161
Family Integrin beta EGF-like domains 0.034
Further Details:      
 
Domain Number - Region: 81-122
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00768
Family EGF-type module 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW015652-PA
Sequence length 1255
Comment (Ixodes scapularis)
Sequence
MRRAQSSTVRLPGSVACRGCSLRLLRQAAEWGGKYLFWSCADIDLVPVSEFHVICSGHGR
IEGGRCLCDHLYSGNVCQYKDECWADSDCGFHGRCINVDATTYPRMQCFCQMGWFGKDCN
RESAVTRESLDFSQYRSRKLSDRFTLYWRILQKSSEIEMVMKVRGTSYAAVGWRPKDLTN
SCKAFPPLPIDSNQRSRREALTTKSPQERTTLFPARPATLPVHGRPLRTTLLSSLKPRTE
PPPVIKPTEPKAEPVAEPTPEPTAEPTPEPAPEPSPEPAAEPSPEPSSEPTPEPSAEPVL
EPSAKPTPEPSAEPAPEPSAEPVPEPSAEPVPEPSAEPAPQPSAEPAPEPSAEPAPKTLA
EFQAKPTSKPNPEPSPEPHAPSEHTQKPESEPSAEPEPQPEPKPEPEPKPEPQPATPEGR
SLGPHDHRYPPSGPYTPKADFHPMDCTDIVMGVARGNLSRVFDMYTRDRSTPRPDEFYGG
RDDLSAAFAYEEDGHTVVLFRKSLLAAELTDQPLEDAQTLVIWARGQEPNDYIHSPKTGL
DEGRARVLDFYRQDEVKYHGHRNQRGSLSLNFHGGKTSKDLCKGEWSYPPGCQAEQCLYS
ITWDVDPRSENVAFEVRSTSADKWTGVGFSEDRRMPKTDAIIGWAEKTGRFYVYDMWLPG
YGEPMNDVHSDVFNVTGQYDGGVVTLRFTRKLDTGDDTNDLGFTEDRCLHLVFPVWGGTY
NSVLRKLGRHARSPHVSKHPLCLRGCRPPPPPTVAPTAPPTAPPPPAPPASEHPIADVRG
ESSDACSGSWRFPELCSGDGCEYAASWSYHAPSDQVLFTVSTRSNKWTGIGFSSNRAMPK
TDAILGWVEETGRFFIMDVWMDGYEAPFLDPVQDVGNMSGSRQDGRTTLSFARRRYSGDA
AYDLDLDQCLYLVFPTHGGVFNAVSKKIRHHEQTPLVSREPVCFMHCHPGAAIPTGPPVP
ETRATSAPSTVSPPLEEYRVKLQLLEPWQASYGVKGSRPFTLLNRQLVDGLEPALNEVVQ
KHQLRLTRVTREPDGLVAEMRLLLAADAEPTEVAQALQAALQPGLLGAVRVNPSSLTVHS
SNAPESRPKQSAIPGVQAGSSPDTSQAKLYAVVAAVAALVLLLLVQAAAMACRRKRQPQP
PAPNREKLLASSHWKDYSTTASSNYSYENFALRAEDDLGPPAGAPHRPASATYERGSTTA
VRPQANPYATTQRTQHQPQELNPDFYFMPHQRRYSGEVVRVFVDYSNPEYTGGAK
Download sequence
Identical sequences B7P4H6
6945.ISCW015652-PA ISCW015652-PA XP_002406030.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]