SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW015997-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6945.ISCW015997-PA
Domain Number 1 Region: 101-155
Classification Level Classification E-value
Superfamily RING/U-box 6e-17
Family ZZ domain 0.0072
Further Details:      
 
Domain Number 2 Region: 395-439
Classification Level Classification E-value
Superfamily UBA-like 0.00000000000255
Family UBA domain 0.004
Further Details:      
 
Domain Number 3 Region: 3-67
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000321
Family PB1 domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW015997-PA
Sequence length 440
Comment (Ixodes scapularis)
Sequence
MTTVKVYLDGSEIRRFVMGDVKDFKAFKATIGQLFPSLAGKDFTLSWRDVDGDPIVMSSD
VELSQATLNMEDGLLRVYATIVQPGAPGASGAPGASGAQAPADKIHAGVLCDVCDTEIHG
VRYKCLQCEDYDMCDPCHLKRTHEEHDMLKLVNPGVRPIWGFPGWKRLWRHCAKSTMGGG
RGHHGWGHRRGGPPGPHRGCPAFRGCPATQAAGPSAEGGATAQDPTHAARVQYHELLNGI
GDTIANLLDPLGINVAYHVERASETAPTPDDHSKKDSATEPMDTTQDGAGGRPKTSEAAA
QSTEAAKTPEAPRSSEPQAAATGGVFCPFGSIPQNLGSVPKPTPAPVPESEPMTEPDVSH
GWTLLNALRESIMVDDSNAAASAPAASPAQQQCNGSKIDTALSQMLVMGFDNEGGWLRQL
LEVKRGDISAVLESLHPSPK
Download sequence
Identical sequences B7P1T8
6945.ISCW015997-PA XP_002433496.1.51680 ISCW015997-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]