SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW016329-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6945.ISCW016329-PA
Domain Number 1 Region: 292-339
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000212
Family Laminin-type module 0.067
Further Details:      
 
Weak hits

Sequence:  6945.ISCW016329-PA
Domain Number - Region: 103-179
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00106
Family APC10-like 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW016329-PA
Sequence length 364
Comment (Ixodes scapularis)
Sequence
MRAARSALVSLLPLLLAAAAARTGGNVGNAYLASMFAAQTQSDPCYDDMNNPRRCIPDFV
NAAFGKEVRTSSECGTPPSRYCNTATDDKGEIVRNCQICDAGNPKRRHPASYLTDLNNPN
NVTCWMSEPFPQPLYNVSLILSLGKKYELTYISLQFCGAKPDSLAVYKSTDYGKSWQPFQ
FYSSQCRKMYGRQNRALITKANEQEPLCTDPQSTTEQLSGARIAFSTLEGRPSAYEFDSS
PVLQEWVTATDVKVVFNRLTNWTPEPLDNDTLVPREASLYYAVSDFAVGGRCKCNGHGSR
CVQNRDGQLACECKHNTAGRDCEKCKPFHFDRPWGRATAHDAHECVREYPEFIPLPVCGS
ECCQ
Download sequence
Identical sequences B7P5R8
6945.ISCW016329-PA XP_002407808.1.51680 ISCW016329-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]