SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW016480-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6945.ISCW016480-PA
Domain Number 1 Region: 1326-1650
Classification Level Classification E-value
Superfamily NHL repeat 4.97e-17
Family NHL repeat 0.01
Further Details:      
 
Domain Number 2 Region: 1015-1090
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000129
Family Pre-dockerin domain 0.067
Further Details:      
 
Weak hits

Sequence:  6945.ISCW016480-PA
Domain Number - Region: 671-695
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000363
Family Integrin beta EGF-like domains 0.072
Further Details:      
 
Domain Number - Region: 1542-1823
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.00133
Family YVTN repeat 0.042
Further Details:      
 
Domain Number - Region: 700-726
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00279
Family Integrin beta EGF-like domains 0.053
Further Details:      
 
Domain Number - Region: 835-860
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00656
Family Integrin beta EGF-like domains 0.031
Further Details:      
 
Domain Number - Region: 865-890
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00893
Family Integrin beta EGF-like domains 0.093
Further Details:      
 
Domain Number - Region: 893-930
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0251
Family EGF-type module 0.029
Further Details:      
 
Domain Number - Region: 736-759
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0279
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW016480-PA
Sequence length 2870
Comment (Ixodes scapularis)
Sequence
MTVSLACRRVVRDPLRGFRPWILAPPTLRQYSSLQPVPADPRQPRRSQLPILSHQCSGDR
KSRVGGGGGNGPSAAGLSSSGSESPDEDVDLEEDEDDENRSDATFTGSELALARDSTLVL
QSRRVPVIPPRNLSMGRTGGGGRAGSCTGGAQGMAQDADQDYEPTCLARTPSGSLFISDL
TKGPGSPQGKTEFRPSNIIQDETKTNPDSWQHGQHPCPVIVDDVEMSSGGEDLKSTYDRQ
HDPASFKSPAPGRPNTRFKRQATDRTSRTVASTEFEDLGSGEEPADFRRPRHTVDADADA
NFKNQLNSKREFNEEPEFQADTVIIVPDDPPATRISRMNCICKRFMAESPSGPPRSGEGD
GLKSPTVKRAKGDTAGTSTKRPRFVSADNNATNNEIPISMPEQGGEPKDMTEVDELKVLE
KNEVELEEEITGSGKATAIGSQIAVKNDVSGGSELPEQDAAEFMLANSETDNRFTGDVDV
EDNQNSLEHFAGAETDIDPLGADKEAGDSGHSKAVTSASGSTEWLEIPDPSVLPAKTLPP
SSDSFMDMSVGKRHSKVIASYGHWNVQFHQLEPALVKFNYTLPTGASVGIYGRRNSVPTH
TRYDFVEILSARDRRHRKSAKVTFFYNMEFIHFLDRGQWYISVYNDGELQQEVSFVSLVA
DVSSLPCPYDCHGHGTCNMGKCDCDPDYAGESCAYRVCPVLCSGRGQYTSGECACQPGWK
GKECQLREDECEVSDCSGHGDCLDGVCRCFPGYKGLHCEEVDCLDPDCSGHGVCVSGMCL
CRKGWKSDCSEPDSDALRCLPDCSGHGQFDLDLQRCVCDDQWTGPDCSQEKCDLDCGSHG
RCQGGECICIEGWTGAKCNEKLCDIRCVEHGQCKNGTCLCIQGWNGRHCTLEGCARSCSS
HGDCVMSDGDWQCRCNSGWDGPDCSIPMEKTCDDRIDNDHDGLTDCADSECCSHKACTNN
PLCFSSSDPLDILLRKQPPAVTASFFQRMQFLIEEDSVQSYARKDSFNNSRASVIRGQVI
SFSGSPLMGIRVGIAGDPSFGFTVTRDSGWFDLMVNGGGAVTLQFRRDPFGLHERTVMVP
WNEIVIVNRVVMNIDSAKALDHRPLACTDHDYDTMKPVVLATWKHGFQGGCPERSAVLAE
SQVVQESIAIPGTALHLVYHSSRAGGYLSTIQLQLTPETIPLTLRLIHLKISIEGILFEK
KFEADPGIKFTYAWNRRNVYRQKVYGVAIATVYVGYEYNNCPAVIWEVQATQVSGHDMSI
SEIGGWNLDIHHRYNFHEGILQKGDGTNIYLKNKPKVLLTAMGDGQQRPLHCLQCNGLAK
DQRLLAPVALASSPDGSIYVGDFNLIRQITIDGKVQTIVELSAAQVAYRYHLAVGPTDSR
LYISDPERYQILQVVSYKDISDVKNNIMVVVGNGAKCLPGDKLLCGDGRPARDAKLAYPK
GIAISMHNELYIADGTNIRMVDRHGIIHTLIGDHYHKNHWKPIPCMGTFSLTQVNLRWPT
ELGINPLDNSLHILDDHMVLRLTPDKRIKIVAGRPLHCPSASGRERSDFATDVFLEAPQS
LAFAPDGDLYIAESDSQLVNRVRVLGSDGRIARFAGAELKCSCLELNCKCFDEDHYLAST
SKLSTISSITVSPDGLLHICDQGNLRLRSVTASLPKPNEQHLYEIYSPETQQVHLFNRHG
QHTATKHILTGKTVYTFSYNVNTSFGKLSTVTDAEGNKIYILRDHSNHVKTIENTQGGKC
QLEMSRMRMLHSFVTPDNFKTVFDYHGSTGLVRSKIDSSGRSVVYGYDEYGRLTEAITPS
GQTIRLSYNLSTKGAAVTVTRDGKDPVSLLIKGFDVTTRIGLSEERITQTPDGSMLLMAE
DASSRDMETVASPVITDLSPVLGETFPVPAKLRTILSDDVSQRFEWRYYLRREGKGRQKQ
IMQVGRKMKVNGDILLAIEFDRDQYSETLYDKNQIGLLTVHYDPLGHPLSWQPTQNVTAV
TLEYDRFGRLIRWERGQLSEKYSFDIRGRLADVRYADGSGIMYKYDDGPISVPTEIILPS
GSRYILQYDVSGSLQAVITPNGHKHEIATQTSIGFYKLLYLAPGVGHPYVLHFNDRGQML
AKFFPKNKGRVVFTYTEEGRLESIMCGPERTDFYYHNSTALVKSITKNVPSLDFRVDYRH
HGSLLKEERHRYNSRSGLDGAKFRYQYDARLSSVEVEINGKTSLTTKYRYNSESGVLDQV
QQFLVHRPKLNSIFIQDEARQYSKTIGTDTYGRLVVLAITLWNKEIFSLGLQYDNRSRIK
HVHTKIGKDGSSHASNYTYTVDGFLEEVSGAQSWRFIYDINGNMKSLWEGPRQISLRHDD
GDRLIGYGDIELYLVDVRGFIVQRGEEKFKFNAMGQLVHAFELHQYEVQYVYDSQNRLIA
RKDHRGNITQFIYADPQHPKAITHMHYPKDSLTFVLIYDTLGHLIYMQQGNNKFYVACDH
LGSPVAVFSSEGGIVKEVQRNPFGKVTYDSNPEFFLPVDFQGGLRDPVTQLIHFGGRVYD
ALGVQWLTPNWESVPALLQKPYDIHLYRFHGNDPINPVRTEDRHLNDLPDWMAALGYDMR
RVLVVPQTKKAPDEDTRVGAPVPETVPVISGLSCIADIVAAEFYRFSTVPKTAVKLDNSF
QRHINSRISNLPSVLGDGILLSREGPKAVVHVVSESSPILRDVMVAIFNDTFMADLRFSL
HGQDSFFFVQPQLSKAEEDWVQLGRLGTMFNITKHVVDSGEGGSTSGGGKNQVDIRMHST
SVVLNIRYGATLHEERHRLMRHARRRAVDDAWTQELELLKNGHKGSNDWTKSEREELLVN
GLVARYFGTDVHDIEKYPELADDPSNMAFRKENSRKRRGKTRRARLKPDV
Download sequence
Identical sequences B7P403
ISCW016480-PA 6945.ISCW016480-PA XP_002405017.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]