SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW018535-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6945.ISCW018535-PA
Domain Number 1 Region: 38-126,197-233
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000000000404
Family SPRY domain 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW018535-PA
Sequence length 240
Comment (Ixodes scapularis)
Sequence
MCVDSHEEDWLRLHDVRLNGPVLEYSGRGASMVDVGLAQTRCPLNTTSHYYELEILDPGE
KCCIAIGLAHNADYPRHRHPGWNEGSIAYHADDGKIFVGSGEGSCFGPRCKKGDVMGCGI
LFPREYVAEEEECGAEERLLDNSPWSLGGPDEDSDNDEGCHCWREADDPFGQEPPDAILV
QVRKSNAGEGLRKSLHVFFTHNGVNVGRREVALPRGGLYPTVGMLSRKEKVKVDLHPLTG
Download sequence
Identical sequences B7PQ06
ISCW018535-PA XP_002435848.1.51680 6945.ISCW018535-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]