SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 6945.ISCW020032-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  6945.ISCW020032-PA
Domain Number 1 Region: 195-427
Classification Level Classification E-value
Superfamily PH domain-like 8.85e-80
Family SSRP1-like 0.00000425
Further Details:      
 
Domain Number 2 Region: 540-620
Classification Level Classification E-value
Superfamily HMG-box 2.88e-20
Family HMG-box 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 6945.ISCW020032-PA
Sequence length 730
Comment (Ixodes scapularis)
Sequence
MDFLEYPDVFKEDRGAMTSGRLKMTNQAVVFKNSKTGKVEQVQGPDIESIDWQRLGAGYG
LRIMMKNGTMYRFGGFQDDEQDRLAKFFKHHFEMPLGTRDLCLKGWNWGTARFEGSVLSF
DIDSKSSAYEIPLGNVSHCTTAKNEVTLEFHQNDDAAVSLMELRFHVPTDPNSDTDPIQA
FRNNVLSKANIIQATGESMVTFKELQCLTPRGRYDIKIFPSFIQLHGKTFDYKIPLTTVL
RLFLLPHKDTRQVFFVLSLDPPIKQGQTRYHFLILLFNKEEETSIELTMSEEDIRDKFED
KIQKNMSGPTFEVISRVMKAVVQRKITVPGNFTGHGGTNCITCSYRAGNGLLYPLERGFI
YIHKPPVHLRFDEIACVNFARSGGSTRSFDFEVEAKSGLVHTFSSIEKEEYGRLFDYVSD
KKLRIKNRGSLGNTTKEKPNYNDDDLVDSDAEDAPDAYLARVKDEGRQRDEGDSDESSDE
SFNPGESGSEVAEEFDSNVSDSSDSEEGGEKEAGGDGEEKPKKEKKSKSAKTVREPGMGP
PRRRKPKKERDENKPKRAPSAYFLWLAENREQIKRDNPGFGITDITKRAGELWKTVTDRS
KWEEAAAKAAAEYKEAMAAYNATRGKKAGSSGDEKEEEGGEEKKKKAPRKRKEAASGGGS
FKSKEFIESSGSSSDEEVKKEDKKAKSPSPQRSSPARSSPARSSPTKSPAKSSIKSGDEE
ASASTPESSE
Download sequence
Identical sequences B7Q220
ISCW020032-PA 6945.ISCW020032-PA XP_002410341.1.51680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]