SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 70448.Q00TC2 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  70448.Q00TC2
Domain Number 1 Region: 191-324
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.93e-28
Family Thioltransferase 0.0019
Further Details:      
 
Domain Number 2 Region: 96-203
Classification Level Classification E-value
Superfamily TPR-like 2.8e-21
Family Tetratricopeptide repeat (TPR) 0.002
Further Details:      
 
Domain Number 3 Region: 4-100
Classification Level Classification E-value
Superfamily TPR-like 0.000000108
Family Tetratricopeptide repeat (TPR) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 70448.Q00TC2
Sequence length 331
Comment (Ostreococcus tauri)
Sequence
MRSDALRRDGNALLRDGNLVDAREKYRSALAAATDDRERALAVGNEAVVAIALGDDATAT
TLCARAWSYDEGYARATTRLEALLTSGRGLGRALEIAKRARDAGNEAFRAGEYEKAMQAY
GEGLETCAGVPGAGILFSNRAACKMRVGDASGALADAEAALARDESFVKAKMRKAAALMT
LGRHREADAVYDALVFELPGDEDLVRSANEARRALGKSERKAGARNVEEWSEYQALVRGA
KLVFVDFTATWCGPCKMIGPTFVSLSTKFPRAHFIKVDVDAAQEIAGQERVSSMPTFAVY
MDGNKVETFSGADANRLTQMVSKHYANARFR
Download sequence
Identical sequences XP_003083927.1.19543 70448.Q00TC2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]