SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 70448.Q017B0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  70448.Q017B0
Domain Number 1 Region: 48-626,684-692
Classification Level Classification E-value
Superfamily Prokaryotic type I DNA topoisomerase 8.63e-161
Family Prokaryotic type I DNA topoisomerase 0.0000000157
Further Details:      
 
Domain Number 2 Region: 923-995
Classification Level Classification E-value
Superfamily HMG-box 2.75e-18
Family HMG-box 0.00084
Further Details:      
 
Domain Number 3 Region: 683-720
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0000391
Family PhnA zinc-binding domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 70448.Q017B0
Sequence length 1006
Comment (Ostreococcus tauri)
Sequence
MRSRVVLLARAALVGRESGGGSARTWTRANANASAAAQNASEQRQNNRTLMIVESPAKAK
TIEKYLGPGAKVLASYGHVRDLLNKQGSVRPEEAFAMTWTSTARQRAAVKDIADALRQAD
VLLLATDPDREGEAISWHLLEVLREKKLLRDNLDVKRVTFGEITKSAVLNAVASPREINT
PMVDAYMARRALDYLFGFTLSGLLWRKLPSSVSLSAGRVQSVALRLICEREEEVESFVSE
PYWTVTANLLSKDGASFDAALTHVDGTKLGKFTIASNDQAETYARRVQECDSLRVTGLKL
SEAKRSSGPPFTTSTMQQEANKQLGFGASRTMSAAQRLYEGAGTGEGLITYMRTDGTYVA
PYAIDGLRDTAIELFGADYVPESPRYFKKTQKNAQEAHEAIRPTKAGRVPAQVAKMLGPG
SDEARLYALIWARAMASQMTPALSDRVAAEISSEDGSLQLKANGNRLKFPGFLAAYRTSR
PDAPPPSNDAWLPELRESDSLAVNVDDQTLGCAATSHTTSPPPRYTDGSIVKALEERGIG
RPSTYAPILKVLAQREYVAKQGAALIPTTRGRLVSAFLTNYFETYVDYGFTANLEQKLDE
ITAENVQWRPLLEEWWTPFKNQISSLSTLRVSEVIDALDEKLGQHLFGEEKYDGYVHVNP
DQVSDVGDGTTTSTNDAQEVSDARKCPSCKTGRLGLKPSKSGGFIGCSRYPECGFTHPLH
PIRGAIVSDTDDADFMASDASSDVLLYPKILGVDPETGSEISLRLGPYGPYLQLGEKAAP
VVSEDGKKAKKPPAPRRVGVANIEKDVSELTLEDAVRLFEYPKEIGKHPMTESPVSINMG
PFGYYVACDGINASVGKSVLKRVGSLDNVTLEEAVELLRKKAERPPRTRGRYAKKADKKA
KKEPKAKKAANEPKEEKAKREPKEKKAMKDPALKKPLTAFFMFSADERANVKAENPTFKI
GDIAKALGERWATLDPERKAKYESDAKAAKEAWTRVATERSKESSS
Download sequence
Identical sequences XP_003079855.1.19543 70448.Q017B0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]