SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7070.D2A2S0 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7070.D2A2S0
Domain Number 1 Region: 24-79
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 5.23e-17
Family Tachycitin 0.0032
Further Details:      
 
Domain Number 2 Region: 379-430
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 2.07e-16
Family Tachycitin 0.0029
Further Details:      
 
Domain Number 3 Region: 481-532
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 2.25e-16
Family Tachycitin 0.0029
Further Details:      
 
Domain Number 4 Region: 583-634
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 2.25e-16
Family Tachycitin 0.0029
Further Details:      
 
Domain Number 5 Region: 136-187
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 2.48e-16
Family Tachycitin 0.0029
Further Details:      
 
Domain Number 6 Region: 258-309
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 2.48e-16
Family Tachycitin 0.0029
Further Details:      
 
Domain Number 7 Region: 694-745
Classification Level Classification E-value
Superfamily Invertebrate chitin-binding proteins 3.14e-16
Family Tachycitin 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7070.D2A2S0
Sequence length 747
Comment (Tribolium castaneum)
Sequence
MYFAVFFITIGLSSFGVNADPTCPKQDGKDSVYFPHEDCTKFWQCSNGTPYLFDCPDNLH
FNPKLNVCDWPNAAGCKGSGEDSDSSSSSSSSSSSESQESGDNSQGKDDNNSSSSSSSSS
SSSSSEEGSSPECPSVDGEDPVYFPHEDCTKFWQCSNGVPYLFNCSANLHFNPKLNVCDW
PDQAGCESKEDSSSGSESKESDDKDDSSSSSSSSSSSESQESGDNSQGKDDNNSSSSSSS
SSSSSSSEEGSSPECPSVDGEDPVYFPHEDCTKFWQCSNGVPYLFNCSANLHFNPKLNVC
DWPDQAGCESKEDSSSGSESKESDDKDDSSSSSSSSSSSESQESGDNSQGKDDNNSSSSS
SSSSSSSSEEGSSPECPSVDGEDPVYFPHEDCTKFWQCSNGVPYLFNCSANLHFNPKLNV
CDWPDQAGCESKEDSSSSSSSSSESKESGNNSESKDDNSSSSSSSSSNSSSSEEGPECPS
VDGENPVYFPHEDCTKFWQCSNGVPYLFNCSANLHFNPKLNVCDWPDQAGCESKEDSSSS
SSSSSESKESGDNSESKDDNSSSSSSSSSSSSSSEEGPECPSVDGENPVYFPHEDCTKFW
QCSNGVPYLFNCSANLHFNPKLNVCDWPDQAGCESKEDSSSSSSSSSSESGDNSQGKDDD
KDDSGNSSSSSSDSSSSSSSSESSEEGPECPSVDGETPVYIPHEDCTKFWQCSNGTPYLF
DCPDNLHFNPKLNVCDWPNAAGCKGNK
Download sequence
Identical sequences D2A2S0
7070.D2A2S0 TC008506

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]