SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7070.D2A556 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7070.D2A556
Domain Number 1 Region: 59-199
Classification Level Classification E-value
Superfamily L domain-like 5.67e-29
Family Ngr ectodomain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7070.D2A556
Sequence length 225
Comment (Tribolium castaneum)
Sequence
MKFYILLTVVTTVWAKCRLQVAEGMPNRTLCTVETLEEDSLKLKNQKNADFLYVDVSHGE
IPKDAFAKLKSRKELWFLGENITYIQPGAFAGLTELDNLAVTNTLITNVSRNSFSGVPNL
KVLSLIKNKIEFIEDGAFSGLGGLQQLLLNENRLRRINETTFHGLEHLQALYLDDNPIEY
IHVNALRKMTNLTRLVISFVKDKTVDEAALDFIDDNRKIVHYVKL
Download sequence
Identical sequences XP_015838255.1.52716 TC015476 7070.D2A556

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]