SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7070.D2A5L6 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7070.D2A5L6
Domain Number 1 Region: 75-352
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 3.02e-51
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.066
Further Details:      
 
Domain Number 2 Region: 758-985
Classification Level Classification E-value
Superfamily RNI-like 4.32e-27
Family Cyclin A/CDK2-associated p19, Skp2 0.05
Further Details:      
 
Weak hits

Sequence:  7070.D2A5L6
Domain Number - Region: 559-607
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0152
Family variant PHD-like domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7070.D2A5L6
Sequence length 1008
Comment (Tribolium castaneum)
Sequence
MAHRGKKLQRSDDRQSYISRMRERKQKKLYSEDWALGDDEIEGRRSFNLQEKLENPLFAT
HNIVKEMHGNELNVAYFQKHGFNTPLLFKEKTGLGLRVPTSNFTINDVRMCVGSRRILDV
MDVNTQKNSEMTMKEWQKYYEDPAKDKLLNVISLEFSHTKLENYVQSPTVVRQVDWVDCV
WPRHLKESQTEATNLLEDMKYPKVQKYCLMSVKGCYTDFHVDFGGTSVWYHILKGSKVFW
LIPPTEHNLALYERWVLSGKQSDIFFGDTVDKCARIVLTEGNTFFIPTGWIHAVYTPMDS
LVFGGNFLHSYGIDKQLKIAHVEDTTKVPQKFRYPFFTEMLWYVLERYVHCLLGNSHLTT
GHDVAIPPDRPHVHLTQAELHGLKEIVMFLHMLPANKKNVPDLIRDPVSLIQDVRTLIGH
HRQDSRELAITGRPVLWLPDDHDRKSLYPRPYAKSNGVRPPKPAFKSKSGLGGGAGDKGG
PRRRRTRCKKCEACQRSDCGECSFCLDMVKFGGPGRAKQTCNMRQCLQPMLPVTAACVHC
GLDGWNQTPVTPLQKGPQRCESASNLMECSVCYEIAHPSCVQRLCPDFTGYINEDMPNSW
ECPMCCKLGKNTDYRPRHFRARQKSSDMRRMSISSDASSAFDSKLHQEHYSDSGSENDNK
DNNKDLLPIKKRRSSEGTPEIETSKSQASDLPRKTAFRMQLAHQIASNSTKMLKKPMVVV
RPAPILMMNPLPGNNLALDKRCVLNIFKYLSPKDLLNCALVCKTWATYSIDPTLWRVMAF
SRKHISSDILKGIVRRQPEVLRLDWCHINKFQLPWLIQRLSNLKELSLVSVNVKTAISLR
TNHSAVLQHLDLSFISDFNDAALREILGPNNDSRRGLADEKIRFRNLRTLKLAGTDVTDI
AMRYVTQYLPNLQHLSLSLCPRISDAGIAQLTTKPATTVGSLVSLDLSHSKLVTETSLEH
LAKCESLVRLDCRHSLQISTQALIKFAAKSDKNLQVRDIKLVDKRLKA
Download sequence
Identical sequences 7070.D2A5L6 TC015153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]