SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7070.XP_967595 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7070.XP_967595
Domain Number 1 Region: 701-879
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000697
Family Fibronectin type III 0.0043
Further Details:      
 
Domain Number 2 Region: 916-1005
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000295
Family Fibronectin type III 0.0037
Further Details:      
 
Weak hits

Sequence:  7070.XP_967595
Domain Number - Region: 96-163
Classification Level Classification E-value
Superfamily FnI-like domain 0.0101
Family Fibronectin type I module 0.053
Further Details:      
 
Domain Number - Region: 156-237
Classification Level Classification E-value
Superfamily FnI-like domain 0.0502
Family VWC domain 0.077
Further Details:      
 
Domain Number - Region: 339-409
Classification Level Classification E-value
Superfamily FnI-like domain 0.0921
Family Fibronectin type I module 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7070.XP_967595
Sequence length 1093
Comment (Tribolium castaneum)
Sequence
MILIVLVFVACVNWTLAQCPEGITGNCTIRHNETSPKPPLLQAMNMLAEDDDHKGRALNF
TMTESNNTHDEHGDLSDVTINEDEEEHDKITAHNVTVCSKGGLTYEEGEKLEIGCESTCT
CRNGKMQCEDRCVKPMVRKGKKIEDPLCIEKDTDDECCAVLVCTADTETEPLEICTFKNH
TYTRGESFNKGCDEVCTCEIAGKTSCKPRCPPVNKTNDKCVEVQDPNDSCCKKLLCDVTL
DDHEADKDYSMQMHKLIEAKYLNESTVELQFDPKLNEKENSIFIEGSADQNDWKTYKIRA
QKYVDVMDGTKYLKLENSKESVKIESAATKTPLENASSSACTYKNKSFELNEEYNDNCTS
LCVCKESGMKCLKLECPTYFGVDVLDPNCIEWETVPPNFHPTPPNCCPQELKCKSNGSCV
YEGHTYQNWQQLPENVTGCEKRCYCEMGNVECQNTCPPVTALPPPTLPCPPHQAIVDHLP
DDECCMYWVCSQESGRNETKMNATEIKTPSKIMGPLLVYKNHNKTDNKNPLEPFTPPNLP
QDENPYYHKNEKDKFLGPYNPNYKQNKKPGLGNNQDELLQFIHQHPEITNYPSGSVVEIH
KPSFNNRPQHFIPYVIPQNGHSDDLPPGITLEQILQEVHKNANPNGHILPFPNHFTNGPV
LLAPQSPILPRHNATFPGQQFPGGFPTMQQDDISVTALEAVDAHTVRLAFVVPSVIVGLH
GRVEVRYTHHDDSDVNSWQLQVFAPPNDLIATPQLEFDLLDLKPDTEYKIKITITLRDLH
NTPSSRIYKIRTLKDLNATTLPPMIPIEPELAISDINATWVTVIWRKFTEYELQFIDGVQ
LRFKEIEGKIYDATPLIHRSVTSYTLENLKPNTKYEIGIFFIPFPGQLTELHAEHMLHFT
TANEIDTYGFNVTLDISHIKSTSVEISWSGVPYPEDKYVNIYRAIYQSDSGKEDHSTFKI
AKRDSPTKTVISDLKPGTRYRLWLEVYLTNGKIKTSNVQDFITKPRAAPALGAATQSDKL
SAGEQKGDYYGPLVIVAILAAIAIMSTLILLLILVRRHNQNKAAITPPPPRVSQSAYDNP
TYKVEIQQETMGL
Download sequence
Identical sequences D6WS97
TC010099 7070.XP_967595 XP_015837411.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]