SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7070.XP_968188 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7070.XP_968188
Domain Number 1 Region: 85-355
Classification Level Classification E-value
Superfamily L domain-like 2.38e-58
Family Internalin LRR domain 0.0046
Further Details:      
 
Domain Number 2 Region: 283-551
Classification Level Classification E-value
Superfamily RNI-like 1.26e-48
Family Cyclin A/CDK2-associated p19, Skp2 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7070.XP_968188
Sequence length 565
Comment (Tribolium castaneum)
Sequence
MTQPSTGNTCLPESEMPEAESSGVLESVKQKKYSSGSLGGDITRPKVVTVKHPESNKPKP
TAKKNKPIQADLDVSKEFLRCRDEGLKRLDLSKSNITHLPPTVRDLIHLSELYLYGNKLV
YLPLEIGCLTNLQTLALSENSLTSLPDSLMSLKSLKVLDLRHNKLNDIPDVVYKLTSLTT
LFLRFNRIRYVDDEIRFLTSLTMLSLRENKIKELPAGIGKLVNLVTFDVSHNHLEHLPEE
IGQCINLSTLDLQHNELLDIPDTIGELQQLTRLGLRYNRLSFIPSSLSNCRHMDEFNVEG
NAISQLPEGLLSSLSELTSITLSRNNFAAYPSGGPSQFTNVDSINLEHNQIDKIPYGIFS
RAKHLTKLNMKENQLTSLPLDVGTWTNMVELNLGTNQLGKLPDDIQALQALEVLVLSNNL
LRRIPPSVGNLRKLRVLDLEENRLEQLPNEIGYLRDLQRLIVQSNQLTSLPRAIGHLANL
VFLSVGENNLAYLPEEIGTLENLESLYVNDNPSLHNLPFELALCSNLQIMSIENCPLSQI
PAEIVAGGPSLVIQYLKMQGPYRAM
Download sequence
Identical sequences D6X3X5
7070.XP_968188 TC011315 XP_968188.1.52716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]