SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7070.XP_968322 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7070.XP_968322
Domain Number 1 Region: 268-327
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000184
Family RING finger domain, C3HC4 0.027
Further Details:      
 
Domain Number 2 Region: 57-80
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000327
Family CCCH zinc finger 0.004
Further Details:      
 
Weak hits

Sequence:  7070.XP_968322
Domain Number - Region: 352-382
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00209
Family CCCH zinc finger 0.0042
Further Details:      
 
Domain Number - Region: 197-222
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0487
Family CCCH zinc finger 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7070.XP_968322
Sequence length 454
Comment (Tribolium castaneum)
Sequence
MADSNQGFSDTQKFCFDYYERNVCKKPGCSLTHKRKNHIDVVQVKPRDGCVIGRLKTAPL
CRYFLRGYCTHAGNCRFRHEIIPVNMRNVPNTNSNQPSSTNTPSTSATELQNANKSEDKR
ASRAESSVHASAASNMNNGKPGEAAVNNAEGAACSPLKDSLWVNAPEFVPKSIATKPLSY
AAAVNPTGAVGNNNSTKQLCPYANKDGFCKYPPGECSYLHGEICDLCGNAALHPYDEELR
KKHRQDCIKQHEKNMELSFAIARSKEKSCGICFEVIMEKANGEQRFGILPNCNHCFCLSC
IRKWRQARQFENKIIRACPECRVTSDFVCPSLFWVDTKEDKNKLIDDYKTALSTKDCKYF
DKGVGKCPFGNKCFYRHAFPDGRVCDVGPPPRQRRRGPGLDNAAIEVLQQVILWDFLDER
DNPWQSLAEDLEDLADFFSDSEESDWSDYDLFIS
Download sequence
Identical sequences D6W6P3
XP_968322.2.52716 7070.XP_968322

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]