SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7070.XP_969309 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7070.XP_969309
Domain Number 1 Region: 103-465
Classification Level Classification E-value
Superfamily RNI-like 0.00000000000000102
Family 28-residue LRR 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7070.XP_969309
Sequence length 475
Comment (Tribolium castaneum)
Sequence
MSPKNQVHPLSYLCVKLVSAQLIQALSDDEGRNYDVVLEYLFDATYEVVQELLKNILNSV
NLDAATRFSCLQVLLRQDVRKLDTGIFPHSYYEAILKVITQKGTGLQQLNLKGVWVRDHP
AQLSELVTNLTKLKILVIPHMADDQVLQAISKAQSLSVLDISGECSFTSSGLRLIRNETL
TCVDIGYFGKKSICQQDESDCDIIAEMIENLPNLTCLRTYSFTGTSLLTLYRKNSKHKTR
LKYLHDTGTSDEVIEAIINMCEQLKSIHLDTPQKGVICRLKQLKKLNCIKLVHHDSADLL
DYLADSGAALQVLKLNHNKRNALDLCDVCLCVPNLHTLECFQLKLAFSQMDTFFMNLENI
EILYCDVSDSSLKCILMNCPFLKRVIIGCVINMTDGDVFRLCAECDFLCLEELWLSCARG
LTCISVELLMGHCPNLKVLGQLSGWDIHQEEIEYLRSVILYTNTDLTLLPLGTFS
Download sequence
Identical sequences D6WCY7
XP_969309.1.52716 TC004956 7070.XP_969309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]