SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7070.XP_969516 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7070.XP_969516
Domain Number 1 Region: 499-623
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.73e-32
Family Ankyrin repeat 0.00029
Further Details:      
 
Domain Number 2 Region: 962-1210
Classification Level Classification E-value
Superfamily RNI-like 8.24e-28
Family 28-residue LRR 0.02
Further Details:      
 
Domain Number 3 Region: 26-98,161-192,240-276,332-379
Classification Level Classification E-value
Superfamily TPR-like 5.6e-16
Family Tetratricopeptide repeat (TPR) 0.071
Further Details:      
 
Domain Number 4 Region: 302-463
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000518
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7070.XP_969516
Sequence length 1285
Comment (Tribolium castaneum)
Sequence
MDEQKLLKRRNKALRENNEGVLISVCTDLANLYVDKGRFDFAIEEYTTVANIYKKQNKQL
EYAVVSRGIGEAYLGLQKFDKALKLQKIYLDIARELKNKLEEQRALATIGHTYLTTYLDS
PEPDKNNLNLANKFFMKSLVVSQSLVGEASKLEIADMCARLYCNLGLVQDSLGNYDKALE
LFTKSINQCKAHDLYEQLQRGYMSLSSLLVKKGDSKAALQQCNLAAETAKKLRNKAVLLA
GIFLSKSEILLKLGDLHGAKNALHKAYKLNTPDVKERKTIENNLKVVASMCYNQDKLLVT
DSTDYPTLKKLYEKMGDGACHLKLYTKALDYYKKMMETAEKAEMTGPDLASCYYSLAETY
KDNGQFEEAVEYFEKELVLCKNLKDSLNTLSNIADTKEAANEPISEVRAVYSRAIESCQR
EGNVHEEGRMLKRQILYLRRQKQHSEAFNLEQSLAKLDFHSSDSEGESSDAQTESVVGAE
IDLEAITDVSDDSDVDQPTTHRRRSKNFQIKRNLKGETQLHTACIKGQLNVVRHLLDQGH
PVNVRDNCGWLPLHEACIHGHLDVVQLLLDKGAAINDRGGTQCEGITPLHDAASNGHLPI
VELLLTRGANAVAKTDEGETVLNFLRKWRTGVQLNNDSQVLYERLVEQISLALQKSGQAV
IVNDDRETQRRSAIVEDSSNPDHRSDMETEAPSTSSLRRSAIIGLEDDDSSSPDRQADDY
RNVMESLRRKNVKSPPKASSSVVKRPALLFDDDIVDDWLDDDLGQRSKKRKTASPVKSAP
SQNCQYYQPPSRSPAKRPKQAKLTHFGHTRTLVEADSTSSPKAPEPAPKLPRPRSFDLGT
DPTLSVDVRIEKKLYRVPVLLSQVATHTIKWLADEAAARYAKKQYIVPTLELETKNGAVL
ADDDPISLLFPMGGTQAEEVEARIVKSNLPPLIDRYKEACQDMGAVPRDSIGQVLQEFSV
GLDLANRGFKGAVLAPLVKVLNRQSNLLELDLSGNFLTNECFDLLAKSLACLESLYKLNL
NCTSLTSGHVQAIVANLNPDVSYKIIDLDFSDNWLRDESFESLALLTRRLQLKKFNLSNN
KFTQNLFNHRLNKDLTLNLDQIEEFDISDNAFDNTTLITILSWLQFANLTHLNVSRNSLS
DNFLHEVLNRMWTQTGPLRVCKLSNCHVTDSEVFDLLRVATSLQHLDVSYNDALTSISLR
RLLQSGIITLDIYACGNIFQYFTEFSKYLDDASRDQNQGKTLKLSPPENSQRETEYLIEM
WRELYGEKTVVELTSKFLGLSVLKV
Download sequence
Identical sequences D7EJH4
XP_969516.1.52716 7070.XP_969516 TC002338

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]