SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7070.XP_970340 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7070.XP_970340
Domain Number 1 Region: 287-596
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-49
Family Kelch motif 0.0061
Further Details:      
 
Domain Number 2 Region: 68-188
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.85e-18
Family Spermadhesin, CUB domain 0.0012
Further Details:      
 
Domain Number 3 Region: 879-926
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000023
Family Laminin-type module 0.011
Further Details:      
 
Weak hits

Sequence:  7070.XP_970340
Domain Number - Region: 658-694
Classification Level Classification E-value
Superfamily Plexin repeat 0.000488
Family Plexin repeat 0.0032
Further Details:      
 
Domain Number - Region: 816-837
Classification Level Classification E-value
Superfamily Plexin repeat 0.0159
Family Plexin repeat 0.0047
Further Details:      
 
Domain Number - Region: 711-740
Classification Level Classification E-value
Superfamily Plexin repeat 0.0262
Family Plexin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7070.XP_970340
Sequence length 1253
Comment (Tribolium castaneum)
Sequence
MLEIFQMFLFLFKSKYRRKCYVWQALCCAVVVLNVCSLVKAKCADCSGNGVCKNETCVCY
DGWQGPQCQFCGGKVRLGTSTGTIHDGLGNYSLSVKCSWLIDAPNTSITLHLEEFATECG
WDHLYIFDGDSVDSPLLAVFSGLMYKGDYNIRRIPEIVAYSGSALVHFFSDDAFNMSGFN
MTYRLNACPSKISGVDCSGNGICIDQVCTCNGGWTGVACHLQKCPDNCGQHDGRGRCEPE
FGCRCESDYKGDDCSQYAPSGYWETVNVESFVPPGSASHGAAVWRDSMYVIAGESYSRRF
MLYVYDFNGNVWETPYISESPSQRYGHSTVIYGDKIFLYGGVMGNRGPTSEVWAFDINAK
TWENITVKAVACNSSVLMCGPLKSAGHTATVIENSTNRKADRMIVLFGHSPHLGYLNTVQ
EYYFGTREWHIVATKGYPVKGGYGHTATWDPLTGKIYVYGGVVSENESAQVLSKSLYSYD
PNTRVWVLLKDAPSARFLHTSTFISGGLMLVFGGNTHNDTLHSFGAKCYSSEFLAYDVTC
DTWQVLQVPKDIHADLARFGHSAVTFEGSLYIYGGFDGQMLSDMLKYTPGSCTNFITSNE
CLSKKPGVKCVWDMRNNFCTAIQNIPVKNLTVQLDGLIIRCPELSRTMITQSLIQNENRC
EKFEDCLSCVQTTSECVWCGNSCMHNKKCRNSSEANIAKLEQCPLDPSPICKQLHTCSAC
TSQPFCRWRFEHAKCVTHPLPSNVTAAAAEPIQCQKVCSEYNSCLNCTQEECIWCQNEGR
CVDKNAYTASFPYGQCREWTTVGSKCRTRGANENSQCSFYSTCAKCRDDPACGWCDDGSR
TGLGKCMPGGYAGPTLHTHSLPSSTCPPDRWHFTTCPLCQCNGHASCIANSSVCLPCQNL
TMGTQCEHCVKGYWGNPVNGGKCQPCECNGQATHCHPESGKCYCTTKGLIGDHCEKCDAT
NHYNSDPINKDSCYYDLTIDYQFTFNLSKKEDRHFTQINFRNSPIKADIDADFSITCSVL
AKMNITIRRGGSKEEKPIYEDFNCTTFRTKFPKSDYNFGVEDNITLTTFYVYVYDFQPPL
WIQISFSQYPKLNLQQFFITFSSCFLLLLLFAAILWKIKQRYDMYRRRQRLFVEMEQMAS
RPFSQVLVELEVKEKLDFDNISVIDLKRKKRDAPSPIALEPCYGNKAAVLSLLVRLPTGC
EPYTVKGQSAGLAIASALVTLGNPRKMSIDQVKTETKSGKSRKSQSQHPDSCL
Download sequence
Identical sequences XP_970340.2.52716 7070.XP_970340 TC012834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]