SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7070.XP_973635 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7070.XP_973635
Domain Number 1 Region: 83-132
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000144
Family TSP-1 type 1 repeat 0.0026
Further Details:      
 
Domain Number 2 Region: 56-82
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000981
Family Somatomedin B domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7070.XP_973635
Sequence length 282
Comment (Tribolium castaneum)
Sequence
METFATLVLVLVGFCMRNGQLVSGGSCREAKLCCPGRDSSCVVQKAPLNAIIEDLSDKPC
YCDHACLKLGDCCPDFKEACGVVDCQVTSWGPWSPCDADCGPGSMSRTRSIKMQPQNGGR
HCPSLEQRRGCQVSTCHHHPDPAIKEIAMLLPGSLSHSRTANATSDIRKNLRLRDPEAYP
QYDPEKTYCVEFQIVKASKACRKEPNYNALKEGERVCVRCESEALHQNLGWRCQGHGVEG
RTTRFSALSAPHCHGKWLRAQAEPDRSCTAKNCEAEHAFIFV
Download sequence
Identical sequences A0A139WGN2
XP_973635.1.52716 7070.XP_973635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]