SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7070.XP_974207 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7070.XP_974207
Domain Number 1 Region: 124-173
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000223
Family HMG-box 0.00076
Further Details:      
 
Domain Number 2 Region: 288-330
Classification Level Classification E-value
Superfamily HMG-box 0.000000000471
Family HMG-box 0.00067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7070.XP_974207
Sequence length 745
Comment (Tribolium castaneum)
Sequence
MASDEDCSTTFTYPIMDDATSSPTTANHYSNCLSPSSSPSPLLPGQYQLTPRYEYQDQDM
IPASQVLPQVLPKSQEMWGDMSQGIYADYRYETNRFNNDYIRQSYAETMPVFTQTRTNFV
PKIGAQGQKVPKEARIRRPMNAFMVWAKVERKKLADENPDLHNADLSKMLGELLRFENNL
LATPKVDKTTQERGGFEYFCLQVANFRTSRVGVSGAWSAFRELCGQLTHIDHSGRTRPPA
WLTLMPERERNTNTGRETYYYAALLLRPDSLPIAHTSPHTLSLIVGCKKWRSLTPQDRRP
FVEEAERLRVIHMTEHPNYKYRPRRRKHNKQRATSGAGGPRVGTSLPSPSLPNMSPRYAG
YIPNASLSPNIQQQNSYGMDFPSPGTADFAAQDKRYSPDTFKYHNQYNYVGYQNYQKSPY
SIQTPDASPSHSPEPKKGPNSPQDCSKDSPREDASLPTPELSPMEHEQFEEKRVSSIQHT
SNLTNPAQQSYNTRVQNYRPNSTNYTNIQPITSVPMANGMYVMSANKSSVEQGHVVTGTF
YPPVATSQDQQLLGTNQNNLNTVANNTNLHYYNASMQQYYPSTNTGYDQDQTKPDTFLTY
QNPLKSDVVNENINSYKSGGLDESYQPQYSSSTLVQSYMGQEERSDVDSDVDTREFDKYL
KFGSTESNMIDSNHNYHRNDNINSNVTYNFQAQHTSVILPNTSVKPEPLLGYPEVYDIGQ
NGVVAKNDDDFSEILADVRKTCYSN
Download sequence
Identical sequences 7070.XP_974207

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]