SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 71421.HI1244 from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  71421.HI1244
Domain Number 1 Region: 3-205
Classification Level Classification E-value
Superfamily CAC2185-like 5.23e-88
Family CAC2185-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 71421.HI1244
Sequence length 206
Comment (Haemophilus influenzae)
Sequence
MNPFQKIKSAVNKRQRFFINRTLQRKLTNQGMTVISANCVGAFILHDLHQPFNSPFVNLY
LSPQDFLRYLQNIDFYLTQPLTFVQTEKSYPVGKLADLEIHFMHYHSEQEANEKWQLRTS
RMKLDNLFIMMTDRDGVTEKDIQLFDQLPFKNKVIFTHKPYPAFKSAYYIKGFEKQNQVG
DIFEFSGWNGKKYYDQFDYVKWFNHA
Download sequence
Identical sequences P44134
NP_439400.1.63031 WP_005694305.1.61635 WP_005694305.1.9694 APC390 HI1244 NYSGXRC-6043a 71421.HI1244 gi|16273163|ref|NP_439400.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]