SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7159.AAEL000846-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7159.AAEL000846-PA
Domain Number 1 Region: 62-172
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000000000235
Family Insect pheromone/odorant-binding proteins 0.01
Further Details:      
 
Weak hits

Sequence:  7159.AAEL000846-PA
Domain Number - Region: 12-64
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00746
Family Insect pheromone/odorant-binding proteins 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7159.AAEL000846-PA
Sequence length 246
Comment (Aedes aegypti)
Sequence
MSPVYSRFFRPDQNDQCSNNRTQRCLEGKIGTIPSLKTCLRAHESVQCYMDQYGEVNSVE
PQFIRFTNLQDEQLVYECAAMLGYSSLDQINALLRDSEFKLHETRCVFRCFMIRSGLYTD
SEGLNMPRYYVLCGGYEDGFYQHVAQCSARLLQEVPCDDKCTLAQRMATECIGIDYATSS
VMQQQGDSSNYVVAAQGSKVYMINDQNANSDVSYSVVNSGGSTNVHNTDSSTNLQGSSMF
FQSTSS
Download sequence
Identical sequences Q17N10
AAEL000846-PA 7159.AAEL000846-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]