SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7159.AAEL003525-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7159.AAEL003525-PA
Domain Number 1 Region: 214-323
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 1.44e-20
Family Insect pheromone/odorant-binding proteins 0.0071
Further Details:      
 
Weak hits

Sequence:  7159.AAEL003525-PA
Domain Number - Region: 130-219
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000641
Family Insect pheromone/odorant-binding proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7159.AAEL003525-PA
Sequence length 370
Comment (Aedes aegypti)
Sequence
MEETDSNLITWHRVYLHREYVHGIGSETRNSLFHLHNARDLVLVTTCRHGKSWRDLQDAR
CDEDNREYDRTVALKAPTMQLRSKCLVLPLLGLCIFANRAVTLQHTATLKSFDELRIECS
RYLPPVDALNNVEDCSDRCLGLVGRFWNDSISRTVYSVSRFYQPDSCDQDNLDRTEQCLC
ETVQSLPRNASCQRASCSMQCYQDQFGELINQKPQFVPVSKLRSAQIMSDCAQVLQISQD
TVRQILHDGYNNTCEGRCLVRCYLIRAGLYSDRRGPNIARFSVQCEGYADEYERSVTDCY
AGLKAQQLDKCTLAARFYDECILSNEYSNSNMDVIAALGGSLYGVILTTVGVTGYLVTSI
VAGLSAAGIP
Download sequence
Identical sequences Q0IG39
AAEL003525-PA 7159.AAEL003525-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]