SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7159.AAEL006417-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7159.AAEL006417-PA
Domain Number 1 Region: 173-281
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.000000000000034
Family Insect pheromone/odorant-binding proteins 0.0037
Further Details:      
 
Domain Number 2 Region: 25-120
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00000000000262
Family Insect pheromone/odorant-binding proteins 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7159.AAEL006417-PA
Sequence length 332
Comment (Aedes aegypti)
Sequence
MFPPRKFLLSSFILAALHVTAAPLWDAKDPEQLRFITSRCMEDWYPKAKNPKAALQNWLG
WKLEPSDDQATQCYTKCVLEKIGFYEPGEKRFKGVRVMQQWETFHKYLNADREKVHDLTS
TFDFIPPLKSSSCSEVFEAFKKVNGKHSETIRAILFGKGESSKKYYQEKGVKIKQKEQSL
FMHCEALNYPKGSPQRKDLCGIRKYQMGSGIVFERHMECIFKGLRYMTSKNELDVDEIAR
DFIVVKKKPDAMKAMMKTCKANLKEKNPGKIAVHYYKCLMNDSKVTNDFKEAFDYREVRS
KDYFAALTGKLKPYSRSDVRKQVDDIDKIQCS
Download sequence
Identical sequences Q0IF93
7159.AAEL006417-PA AAEL006417-PA XP_001657778.1.48696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]