SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7159.AAEL007882-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7159.AAEL007882-PA
Domain Number 1 Region: 140-216
Classification Level Classification E-value
Superfamily HMG-box 2.36e-17
Family HMG-box 0.00071
Further Details:      
 
Domain Number 2 Region: 293-379
Classification Level Classification E-value
Superfamily HMG-box 0.0000451
Family HMG-box 0.0048
Further Details:      
 
Weak hits

Sequence:  7159.AAEL007882-PA
Domain Number - Region: 221-271
Classification Level Classification E-value
Superfamily HMG-box 0.00144
Family HMG-box 0.0045
Further Details:      
 
Domain Number - Region: 549-625
Classification Level Classification E-value
Superfamily HMG-box 0.0718
Family HMG-box 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7159.AAEL007882-PA
Sequence length 661
Comment (Aedes aegypti)
Sequence
MRKRSMSVFVARENNRLSKKFEGVASDNEAPSDSENEELATEIHLEETKAEIDDDLSDDW
SRHEYEVLVAQLKGTLPKKDLRKWKTSLEAVDWSSIKVGKRPTEEVERVAKEVIGKVRRF
RVLSEMLEEVPDVVSKKLCATRPKPPLTAYSLFVKEKLPQLREEHKDLKVQQIFKLIPEQ
YKALSAKKRRRYESDAAKKKEEYHVQLAKFYEEHPDLSPKKGYKPKKEPLKTPFHLFYQE
RREISSNISFQQARKEWEELPVKDKVVFIQRSFEVQGNTDLKLVNKKEMEWLGQSLGKPE
FCGRNSYEYYRRKMKAHSGKEHEAKIREGYKNLTEQEQEALKEEYQVARAKFVNQYREYI
KKLPKEKQQAEIDFLLTISEKKTAAAKKVKSEKANAAMDEDHYLDSPEEPPAAESTTIKK
KVPAKMSTKVAAIKKEHKSDNSDADSVDHAPPSTKKPTRTATAPSTPVASVASPSKRKQT
LSVTKTEPHPSASSSDEDEEEVRSPAKRPAASPVKNGKKRTSSEDQSPAVATKKTKVKKE
PEQQATKSTPKEPEKPPRDPEEFYRQRIYKGKVGKHKESYANLSSAKKREIVEQLKAAQK
QYIVDFELFLKSLPKEEIRKYIQQRAKEQQKVEKTEDSDDDDDDEDDEEDGSSSGDEDDD
E
Download sequence
Identical sequences Q170L1
7159.AAEL007882-PA XP_001652959.1.48696 AAEL007882-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]