SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7159.AAEL009433-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7159.AAEL009433-PA
Domain Number 1 Region: 30-139
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000000000017
Family Insect pheromone/odorant-binding proteins 0.014
Further Details:      
 
Weak hits

Sequence:  7159.AAEL009433-PA
Domain Number - Region: 163-254
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.00916
Family Insect pheromone/odorant-binding proteins 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7159.AAEL009433-PA
Sequence length 278
Comment (Aedes aegypti)
Sequence
MGLATTSIALLVLSLAAVGRCDLPQYSVYKSLFTALYECGEYLQVDNVTLDQYIYYGYPS
IPEVKRLIHCAMVNVGAWNDNIGVRPNVFRYFFKPNELDTEYEERTQQCLAQICPNEYDQ
NYRAFETFSCYYRQYGRLVKEDVFNPLETLEFLQLLQFIKLVLNIPNEKVVQFAAGDYLN
DPLFKQALYIGVVRIGALSRDKGFLPDVGYAQYGYPQLISPCVQKCIADVAAQYMNADKR
ELVYQVYVQCWYSFLDPFLRSQFQAALDGSLCDVQVKY
Download sequence
Identical sequences Q16F73
AAEL009433-PA AAEL014874-PA XP_001649879.1.48696 7159.AAEL009433-PA 7159.AAEL014874-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]