SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7165.AGAP000640-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7165.AGAP000640-PA
Domain Number 1 Region: 31-147
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 3.01e-26
Family Insect pheromone/odorant-binding proteins 0.01
Further Details:      
 
Domain Number 2 Region: 152-259
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 3.66e-16
Family Insect pheromone/odorant-binding proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 7165.AGAP000640-PA
Sequence length 334
Comment (Anopheles gambiae)
Sequence
MATIKLKYITLACVLAATVTAGSHCHNDYYQLKSVSQAQEECARYQGIPCARLAVYNKYI
YPNDTQTQCMVRCMGLNLGWWNDTHGVQEPAMRSFFHPDPDDCDYERRTYHCLNSQRLNH
PSPHVDVCERAYESFRCYYEQYGNIVVTPQFVPLSDLQQVDVLLQCANMLPLTVGRSCAG
GSKPSERDVDCLARCFLLRSGLYSEQHGPHLDRLYVQCNNYANETRFRETTGTCYRRLKS
ECQDECVLAGRFLRECFYEGGLLGSIPVLGGLGGLVGGLTGLTGLVPPVTLQLTSPGLAA
VTLTLSAPSVMVGALPVPPVMVGTLGGAANVGIL
Download sequence
Identical sequences Q8I8Q1
AGAP000640-PA XP_311167.1.40869 7165.AGAP000640-PA AGAP000640-PA|odorant

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]