SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7165.AGAP001017-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7165.AGAP001017-PA
Domain Number 1 Region: 110-165
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000208
Family EGF-type module 0.02
Further Details:      
 
Domain Number 2 Region: 70-106
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000332
Family EGF-type module 0.011
Further Details:      
 
Domain Number 3 Region: 24-67
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000143
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7165.AGAP001017-PA
Sequence length 168
Comment (Anopheles gambiae)
Sequence
MLGHFAELLICTSRYTGDFCDFPNPCHTAAGPRCQNGGICETTFRDGVPSFSCRCPIGYT
ASLCEIPVKNACDSSPCNNGGNCKLKTLDDYTCICATGYSGKHCDKQNLCASSPCRNGGT
CTLSPNGHVKCICPKGFRGMYCADDIDECLKNPCENNGKCVNTHGSYQ
Download sequence
Identical sequences 7165.AGAP001017-PA AGAP001017-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]