SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7165.AGAP002187-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7165.AGAP002187-PA
Domain Number 1 Region: 39-82
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000327
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 5-42
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000353
Family LDL receptor-like module 0.00098
Further Details:      
 
Domain Number 3 Region: 89-127
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000144
Family LDL receptor-like module 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 7165.AGAP002187-PA
Sequence length 127
Comment (Anopheles gambiae)
Sequence
SPESSCPGDKFRCKNGRCILKRWQCDGERDCADGSDEDAQQCLVKTCPANEVLCKTADRC
IPKTWLCDREADCPDGSDEQNCGKLIVTKVCSSEEFTCRSGTGNCIPLGWMCDQNRDCAD
GSDEMSC
Download sequence
Identical sequences AGAP002187-PA 7165.AGAP002187-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]