SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 7165.AGAP002381-PA from STRING v9.0.5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7165.AGAP002381-PA
Domain Number 1 Region: 107-352
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.16e-52
Family TNF-alpha converting enzyme, TACE, catalytic domain 0.0000011
Further Details:      
 
Domain Number 2 Region: 364-442
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.0000000000321
Family Blood coagulation inhibitor (disintegrin) 0.00059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 7165.AGAP002381-PA
Sequence length 616
Comment (Anopheles gambiae)
Sequence
MESHVNAHIDDGVMTASVVLPDETYHIEPSWRHLPHLSDKHMIAYRTSDIKFSWDQVDAI
SGDLGVPRTCGYIKEGLELEGQDAEEDEEIAGDTERYETDNQYEYTPTKTRCPLLLVADY
RFFQEMGGSNTKTTINYLISLIDRVHKIYNDTIWQDRSDQEGFKGMGFVIKKIVVHSEPT
RVRGGEAHYNMVREKWDVRNLLEVFSREYSHKDFCLAHLFTDLKFEGGILGLAYVGSPRR
NSVGGICTPEYFKNGYTLYLNSGLSSSRNHYGQRVITREADLVTAHEFGHNWGSEHDPDI
PECSPSASQGGSFLMYTYSVSGYDVNNKKFSPCSLRSIRKVLQAKSGRCFSEPEESFCGN
LRVEGDEQCDAGLLGTEDNDACCDKNCKLRRNQGAVCSDKNSPCCQNCQYMMAGVKCREA
QYATCEQEARCTGNHAECPKSPPMSDGTMCQERGQCRNGKCVPYCETQGLQSCMCDIIAD
ACKRCCRQSINETCFPVEPPDVLPDGTPCIQGFCNKGMCEKTIQDVVERFWDIIEEININ
KVLRFLRDNIVMAVVMLTALFWIPVSCVISYFDRKKRKEDWKEYEWSQKLDLIHPSDRRR
VIHIRVPRQKITVARM
Download sequence
Identical sequences 7165.AGAP002381-PA AGAP002381-PA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]